dbPTM

YNQ5_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YNQ5_YEAST
UniProt AC	P53891
Protein Name	Uncharacterized protein YNL165W
Gene Name	YNL165W
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	406
Subcellular Localization
Protein Description
Protein Sequence	MDRVRSLIGNRRGRRHNRQHPPYPHSGSPSTVNLLGANGYGDDQSTIFARENESLETSANEGDDSADAATLNTAVSEGSTIGDLQRQGYVNRAPRFTSERAMPFVSVLLQRGFFAFPSEESLQLFLHNKRKLDNIDPKRGLGLPLFHAISLNLVKSLFSDQNTPVMRIYKYVMIDSQCDKPPLNSEVVSRINENVSIYKYEFCTILKKMESHNFSSRVEHDFIFHRKDEPDVHIPMINYNQRKNADTAIHGLNLRWYGTTSLASPFGSNSINLLVLDDTMASYMNQQTIEEFDSYSRSRPTRPLGYLPVWARYTDDKVSVIPKKRTLRVATLYLQETDSFDDGSSLTSTNYTEMGSNIIENVPWDSQILTCMCMLLHEYESRKEKRHTAWGSSTTYMLNGPAGLLM

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
180	Ubiquitination	MIDSQCDKPPLNSEV EECCCCCCCCCCHHH	57.04	23749301

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YNQ5_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YNQ5_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YNQ5_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HRP1_YEAST	HRP1	genetic	27708008
SWD1_YEAST	SWD1	genetic	27708008
PRM9_YEAST	PRM9	genetic	27708008
SHE1_YEAST	SHE1	genetic	27708008
SEF1_YEAST	SEF1	genetic	27708008
CSG2_YEAST	CSG2	genetic	27708008
LDH1_YEAST	LDH1	genetic	27708008
SSH1_YEAST	SSH1	genetic	27708008
APE3_YEAST	APE3	genetic	27708008
SGF29_YEAST	SGF29	genetic	27708008
NPP1_YEAST	NPP1	genetic	27708008
MTU1_YEAST	SLM3	genetic	27708008
RS29B_YEAST	RPS29B	genetic	27708008
YD176_YEAST	YDL176W	genetic	27708008
VMS1_YEAST	VMS1	genetic	27708008
CWC15_YEAST	CWC15	genetic	27708008
MRB1_YEAST	PHO92	genetic	27708008
SAC7_YEAST	SAC7	genetic	27708008
YD415_YEAST	YDR415C	genetic	27708008
PMD1_YEAST	PMD1	genetic	27708008
YG036_YEAST	YGL036W	genetic	27708008
BUB1_YEAST	BUB1	genetic	27708008
MPC3_YEAST	MPC3	genetic	27708008
SNF6_YEAST	SNF6	genetic	27708008
OSH3_YEAST	OSH3	genetic	27708008
MAD3_YEAST	MAD3	genetic	27708008
MTC1_YEAST	MTC1	genetic	27708008
RPA34_YEAST	RPA34	genetic	27708008
MOG1_YEAST	MOG1	genetic	27708008
YJ49_YEAST	YJR079W	genetic	27708008
IME1_YEAST	IME1	genetic	27708008
MRT4_YEAST	MRT4	genetic	27708008
MDM35_YEAST	MDM35	genetic	27708008
CBT1_YEAST	CBT1	genetic	27708008
UBI4P_YEAST	UBI4	genetic	27708008
VPS13_YEAST	VPS13	genetic	27708008
RL22A_YEAST	RPL22A	genetic	27708008
ENV10_YEAST	ENV10	genetic	27708008
ATG26_YEAST	ATG26	genetic	27708008
CDA1_YEAST	CDA1	genetic	27708008
MOT3_YEAST	MOT3	genetic	27708008
SIN3_YEAST	SIN3	genetic	27708008
TOP1_YEAST	TOP1	genetic	27708008
NOP12_YEAST	NOP12	genetic	27708008
YO114_YEAST	YOL114C	genetic	27708008
PALA_YEAST	RIM20	genetic	27708008
MSC6_YEAST	MSC6	genetic	27708008
PMA2_YEAST	PMA2	genetic	27708008
GGPPS_YEAST	BTS1	genetic	27708008
HSP7F_YEAST	SSE1	genetic	27708008
RU2A_YEAST	LEA1	genetic	27708008
YAR1_YEAST	YAR1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YNQ5_YEAST

Related Literatures of Post-Translational Modification