YB112_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YB112_YEAST
• UniProt AC: Q3E7Y4
• Protein Name: Putative uncharacterized helicase-like protein YBL112C
• Gene Name: YBL112C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 105
• Protein Sequence: MQVLIGTKLVTEGIDIKQLMMVIMLDNRLNIIELIQGVGRLRDGGLCYLLSRKNSWAARNRKGELPPIKEGCITEQVREFYGLESKKGKKGPACWMLWLQDRPVC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
55	Phosphorylation	YLLSRKNSWAARNRK EEEECCCCHHHHHCC	22.56	27214570

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YB112_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YB112_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YB112_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDC24_YEAST	CDC24	genetic	27708008
DPOA2_YEAST	POL12	genetic	27708008
TRS23_YEAST	TRS23	genetic	27708008
TFC6_YEAST	TFC6	genetic	27708008
RBA50_YEAST	RBA50	genetic	27708008
PANK_YEAST	CAB1	genetic	27708008
MED6_YEAST	MED6	genetic	27708008
FDFT_YEAST	ERG9	genetic	27708008
STS1_YEAST	STS1	genetic	27708008
GWT1_YEAST	GWT1	genetic	27708008
TAD3_YEAST	TAD3	genetic	27708008
LIP1_YEAST	LIP1	genetic	27708008
DIB1_YEAST	DIB1	genetic	27708008
BUR1_YEAST	SGV1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.