UniProt ID | FYV7_YEAST | |
---|---|---|
UniProt AC | Q12247 | |
Protein Name | rRNA-processing protein FYV7 | |
Gene Name | FYV7 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 151 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | Involved in the processing of the 20S pre-rRNA. Required for survival upon K1 Killer toxin exposure.. | |
Protein Sequence | MGTAKQNQNRKKFTREYKVKEIQRSITKKTRLRKEYLKALKDEGYAVPEKEPKTVAKESVRKIKEARAIEGKKKLDEKKEIKKQRKRMQKDELNKQRNEQLERIRVSKEKFQRREDRKKKLTQRTRTGQPLMGPKIEDLLDKIKTDDTYTS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
36 | Phosphorylation | KTRLRKEYLKALKDE HHHHHHHHHHHHHHC | 19.28 | 27017623 | |
41 | Acetylation | KEYLKALKDEGYAVP HHHHHHHHHCCCCCC | 59.60 | 25381059 | |
90 | Acetylation | KQRKRMQKDELNKQR HHHHHHHHHHHHHHH | 43.77 | 25381059 | |
142 | Acetylation | KIEDLLDKIKTDDTY HHHHHHHHHHCCCCC | 46.18 | 22865919 | |
145 | Phosphorylation | DLLDKIKTDDTYTS- HHHHHHHCCCCCCC- | 42.45 | 19779198 | |
148 | Phosphorylation | DKIKTDDTYTS---- HHHHCCCCCCC---- | 31.35 | 27717283 | |
149 | Phosphorylation | KIKTDDTYTS----- HHHCCCCCCC----- | 16.39 | 19779198 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FYV7_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FYV7_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FYV7_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...