YEI5_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YEI5_YEAST
• UniProt AC: P39972
• Protein Name: Uncharacterized protein YEL075C
• Gene Name: YEL075C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 122
• Protein Sequence: MKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKVVISVMVGKNVKKFLTFVEDEPDFQGGPIPSNKPRDGLHVVSSAYFEIQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
11	Ubiquitination	SDRRKFEKANFDEFE HHHHHHHHCCHHHHH	52.33	17644757
24	Ubiquitination	FESALNNKNDLVHCP HHHHHCCCCCCEECC	51.25	17644757

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YEI5_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YEI5_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YEI5_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TAF12_YEAST	TAF12	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
RBA50_YEAST	RBA50	genetic	27708008
PANK_YEAST	CAB1	genetic	27708008
NOP2_YEAST	NOP2	genetic	27708008
NOG2_YEAST	NOG2	genetic	27708008
CLP1_YEAST	CLP1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.