| UniProt ID | YPI1_YEAST | |
|---|---|---|
| UniProt AC | P43587 | |
| Protein Name | Type 1 phosphatases regulator YPI1 | |
| Gene Name | YPI1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 155 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Regulator of type 1 phosphatases which maintains protein phosphatase activity under strict control. Regulates the nuclear localization of type 1 phosphatase GLC7 and SDS22, and is involved in the regulation of mRNA 3'-end processing. May also regulate the activity of type 1 phosphatase PPZ1.. | |
| Protein Sequence | MSGNQMAMGSEQQQTVGSRTVSVEEVPAVLQLRATQDPPRSQEAMPTRHNVRWEENVIDNENMNKKKTKICCIFHPQNEDEEECNHHSDDDGSSSSGSSSSESENEKDLDFNERRQRRLERRHRKLEKKRSYSPNAYEIQPDYSEYRRKQQEKKD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSGNQMAMG ------CCCCCCCCC | 46.59 | 22814378 | |
| 2 | Phosphorylation | ------MSGNQMAMG ------CCCCCCCCC | 46.59 | 24909858 | |
| 10 | Phosphorylation | GNQMAMGSEQQQTVG CCCCCCCCHHCCCCC | 21.10 | 28132839 | |
| 15 | Phosphorylation | MGSEQQQTVGSRTVS CCCHHCCCCCCCEEC | 23.61 | 22369663 | |
| 18 | Phosphorylation | EQQQTVGSRTVSVEE HHCCCCCCCEECHHH | 22.05 | 22369663 | |
| 20 | Phosphorylation | QQTVGSRTVSVEEVP CCCCCCCEECHHHHC | 20.87 | 22369663 | |
| 22 | Phosphorylation | TVGSRTVSVEEVPAV CCCCCEECHHHHCCE | 24.17 | 22369663 | |
| 35 | Phosphorylation | AVLQLRATQDPPRSQ CEEEEEECCCCCCCC | 27.37 | 22369663 | |
| 41 | Phosphorylation | ATQDPPRSQEAMPTR ECCCCCCCCCCCCCC | 37.84 | 22369663 | |
| 47 | Phosphorylation | RSQEAMPTRHNVRWE CCCCCCCCCCCCCCH | 31.32 | 22369663 | |
| 131 | Phosphorylation | RKLEKKRSYSPNAYE HHHHHHHCCCCCCHH | 38.55 | 22369663 | |
| 132 | Phosphorylation | KLEKKRSYSPNAYEI HHHHHHCCCCCCHHC | 31.98 | 22369663 | |
| 133 | Phosphorylation | LEKKRSYSPNAYEIQ HHHHHCCCCCCHHCC | 16.96 | 22369663 | |
| 137 | Phosphorylation | RSYSPNAYEIQPDYS HCCCCCCHHCCCCHH | 21.87 | 22369663 | |
| 143 | Phosphorylation | AYEIQPDYSEYRRKQ CHHCCCCHHHHHHHH | 15.30 | 22890988 | |
| 144 | Phosphorylation | YEIQPDYSEYRRKQQ HHCCCCHHHHHHHHH | 35.22 | 22890988 | |
| 146 | Phosphorylation | IQPDYSEYRRKQQEK CCCCHHHHHHHHHHH | 15.13 | 22890988 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YPI1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YPI1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YPI1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-20; SER-22; SER-131;TYR-132; SER-133 AND TYR-137, AND MASS SPECTROMETRY. | |
| "Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-131 AND SER-133, ANDMASS SPECTROMETRY. | |
| "Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-131 AND SER-133, ANDMASS SPECTROMETRY. | |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-133, AND MASSSPECTROMETRY. | |
| "Quantitative phosphoproteomics applied to the yeast pheromonesignaling pathway."; Gruhler A., Olsen J.V., Mohammed S., Mortensen P., Faergeman N.J.,Mann M., Jensen O.N.; Mol. Cell. Proteomics 4:310-327(2005). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-22 AND SER-133, AND MASSSPECTROMETRY. | |
