| UniProt ID | YA066_YEAST | |
|---|---|---|
| UniProt AC | P0CX18 | |
| Protein Name | Putative GPI-anchored protein YAR066W | |
| Gene Name | YAR066W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 203 | |
| Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor . |
|
| Protein Description | ||
| Protein Sequence | MFNRFNKFQAAVALALLSRGALGDSYTNSTSSADLSSITSVSSASASATASDSLSSSDGTVYLPSTTISGDLTVTGKVIATEAVEVAAGGKLTLLDGEKYVFSSDLKVHGDLVVEKSEASYEGTAFDVSGETFEVSGNFSAEETGAVSASIYSFTPSSFKSSGDISLSLSKAKKGEVTFSPYSNAGTFSLSNAILNGGSVSGL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 28 | N-linked_Glycosylation | ALGDSYTNSTSSADL CCCCCCCCCCCCCCH | 34.75 | - | |
| 81 | Phosphorylation | VTGKVIATEAVEVAA EECEEEEEEEEEECC | 17.22 | 28889911 | |
| 100 | Phosphorylation | TLLDGEKYVFSSDLK EEECCCEEEEECCCE | 11.48 | 28889911 | |
| 138 | N-linked_Glycosylation | ETFEVSGNFSAEETG CEEEEECCCCHHHCC | 21.86 | - | |
| 184 | GPI-anchor | VTFSPYSNAGTFSLS EEEECCCCCCEEEEC | 36.22 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YA066_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YA066_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YA066_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...