| UniProt ID | IF1A_YEAST | |
|---|---|---|
| UniProt AC | P38912 | |
| Protein Name | Eukaryotic translation initiation factor 1A | |
| Gene Name | TIF11 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 153 | |
| Subcellular Localization | ||
| Protein Description | Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits.. | |
| Protein Sequence | MGKKNTKGGKKGRRGKNDSDGPKRELIYKEEGQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEARTLKNQGELPENAKINETDNFGFESDEDVNFEFGNADEDDEEGEDEELDIDDI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 16 | Acetylation | GKKGRRGKNDSDGPK CCCCCCCCCCCCCCC | 56.63 | 25381059 | |
| 19 | Phosphorylation | GRRGKNDSDGPKREL CCCCCCCCCCCCEEE | 54.59 | 25521595 | |
| 28 | Phosphorylation | GPKRELIYKEEGQEY CCCEEEEEEHHHHHH | 25.60 | 19823750 | |
| 29 | Acetylation | PKRELIYKEEGQEYA CCEEEEEEHHHHHHH | 42.15 | 24489116 | |
| 35 | Phosphorylation | YKEEGQEYAQITKML EEHHHHHHHHHHHHH | 8.91 | 19823750 | |
| 39 | Phosphorylation | GQEYAQITKMLGNGR HHHHHHHHHHHCCCC | 9.79 | 28889911 | |
| 56 | Acetylation | ASCFDGNKRMAHIRG EEEECCCCEEEHHHH | 49.43 | 25381059 | |
| 94 | Ubiquitination | DQCDVVHKYNLDEAR CCCCEEEECCHHHHH | 24.99 | 23749301 | |
| 94 | Acetylation | DQCDVVHKYNLDEAR CCCCEEEECCHHHHH | 24.99 | 25381059 | |
| 125 | Phosphorylation | TDNFGFESDEDVNFE CCCCCCCCCCCCCCC | 44.00 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IF1A_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IF1A_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IF1A_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125, AND MASSSPECTROMETRY. | |
