UniProt ID | ATE1_YEAST | |
---|---|---|
UniProt AC | P16639 | |
Protein Name | Arginyl-tRNA--protein transferase 1 | |
Gene Name | ATE1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 503 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Involved in the post-translational conjugation of arginine to the N-terminal aspartate or glutamate of a protein. This arginylation is required for degradation of the protein via the ubiquitin pathway. Does not arginylate cysteine residues (By similarity).. | |
Protein Sequence | MSDRFVIWAPSMHNEPAAKCGYCHGNKGGNMDQLFALDSWAHRYMNKMDVVKIENCTIGSFVEHMDVATYDRMCNMGFRRSGKFLYKVDPLRNCCRLYTIRTAPQELNMTKELKKCISRFATRITSEDYCPAAVASSDFVGKIVNAEMNSKTFYTRFEPALYSEEKYHLFVKYQEKVHQDYNNSPKSFKRFLCDTPFGPEAVLGTQESWEQLNNWQRMKPGEKLKHMGPVHECYYYEGKLIAITVSDILPSGISSVYFIWDPDYSKWSLGKLSALRDLAIIQRTNLQYYYLGYYIEDCPKMNYKANYGAEVLDVCHSKYIPLKPIQDMISRGKLFVIGEEETKVTKELYLVDSETGRGEGFPTDNVVKYKNIAEEIYGVGGCAFKSANESALELKELYGIPYEEEDLDTIYHLKEHNGHAPNGIPNVVPGLLPLWELLDIMQSGKITDLEGRLFLFEIETEGIRPLINFYSEPPNVKKRICDVIRLFGFETCMKAVILYSEQM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Phosphorylation | EPAAKCGYCHGNKGG CCCHHCCCCCCCCCC | 7.25 | 25521595 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ATE1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ATE1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ATE1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SKG3_YEAST | SKG3 | physical | 16554755 | |
CDC73_YEAST | CDC73 | physical | 16554755 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...