UniProt ID | YN162_YEAST | |
---|---|---|
UniProt AC | Q3E7A8 | |
Protein Name | Uncharacterized protein YNL162W-A | |
Gene Name | YNL162W-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 72 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | ||
Protein Sequence | MSDKPDSQVFCPNCNERLQKCLVQQNYAIIICPSLVCGYPFNQREVLENLTYVDDNDVLKVAKKRLSSRSKP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YN162_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YN162_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YN162_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YN162_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TSC3_YEAST | TSC3 | genetic | 27708008 | |
SCC1_YEAST | MCD1 | genetic | 27708008 | |
BCP1_YEAST | BCP1 | genetic | 27708008 | |
PSA1_YEAST | SCL1 | genetic | 27708008 | |
SWC4_YEAST | SWC4 | genetic | 27708008 | |
RPF1_YEAST | RPF1 | genetic | 27708008 | |
ORC6_YEAST | ORC6 | genetic | 27708008 | |
PRI2_YEAST | PRI2 | genetic | 27708008 | |
NTR2_YEAST | NTR2 | genetic | 27708008 | |
NEP1_YEAST | EMG1 | genetic | 27708008 | |
CD123_YEAST | CDC123 | genetic | 27708008 | |
NSE5_YEAST | NSE5 | genetic | 27708008 | |
ORC1_YEAST | ORC1 | genetic | 27708008 | |
ROT1_YEAST | ROT1 | genetic | 27708008 | |
GPI2_YEAST | GPI2 | genetic | 27708008 | |
MCM4_YEAST | MCM4 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...