UniProt ID | MTNB_YEAST | |
---|---|---|
UniProt AC | P47095 | |
Protein Name | Methylthioribulose-1-phosphate dehydratase {ECO:0000255|HAMAP-Rule:MF_03116} | |
Gene Name | MDE1 {ECO:0000255|HAMAP-Rule:MF_03116} | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 244 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | Catalyzes the dehydration of methylthioribulose-1-phosphate (MTRu-1-P) into 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P).. | |
Protein Sequence | MSSQDVLIHSDDPCHPANLICTLCKQFFHNNWCTGTGGGISIKDPNTNYYYLAPSGVQKEKMIPEDLFVMDAQTLEYLRSPKLYKPSACTPLFLACYQKKNAGAIIHTHSQNAVICSLLFGDEFRIANIEQIKAIPSGKVDPVTKKPMALSFFDTLKIPIIENMAHEDELIDDLHKTFKDYPDTCAVIVRRHGIFVWGPTIDKAKIFNEAIDYLMELAIKMYQMGIPPDCGIGEEKKHLKMASP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSSQDVLIH ------CCCCCEEEC | 36.38 | 30377154 | |
3 | Phosphorylation | -----MSSQDVLIHS -----CCCCCEEECC | 29.15 | 28889911 | |
10 | Phosphorylation | SQDVLIHSDDPCHPA CCCEEECCCCCCCHH | 36.39 | 30377154 | |
99 | Acetylation | LFLACYQKKNAGAII HHHHHHHHCCCCEEE | 22.86 | 24489116 | |
144 | Phosphorylation | SGKVDPVTKKPMALS CCCCCCCCCCCCCCH | 38.44 | 19795423 | |
179 | Acetylation | DDLHKTFKDYPDTCA HHHHHHHCCCCCCEE | 62.68 | 24489116 | |
203 | Acetylation | VWGPTIDKAKIFNEA EECCCCCHHHHHHHH | 47.96 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MTNB_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MTNB_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MTNB_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MTNB_YEAST | MDE1 | physical | 10688190 | |
MTNB_YEAST | MDE1 | physical | 18719252 | |
LTE1_YEAST | LTE1 | genetic | 20093466 | |
PYC2_YEAST | PYC2 | genetic | 20093466 | |
INO2_YEAST | INO2 | genetic | 20093466 | |
HAP2_YEAST | HAP2 | genetic | 20093466 | |
PCP1_YEAST | PCP1 | genetic | 20093466 | |
RSC2_YEAST | RSC2 | genetic | 20093466 | |
HSP7F_YEAST | SSE1 | genetic | 20093466 | |
TPS2_YEAST | TPS2 | genetic | 27708008 | |
DEP1_YEAST | DEP1 | genetic | 27708008 | |
INO2_YEAST | INO2 | genetic | 27708008 | |
RV167_YEAST | RVS167 | genetic | 27708008 | |
SNF6_YEAST | SNF6 | genetic | 27708008 | |
SDS3_YEAST | SDS3 | genetic | 27708008 | |
RAS2_YEAST | RAS2 | genetic | 27708008 | |
HSP7F_YEAST | SSE1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...