UniProt ID | AP2S_YEAST | |
---|---|---|
UniProt AC | Q00381 | |
Protein Name | AP-2 complex subunit sigma | |
Gene Name | APS2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 147 | |
Subcellular Localization |
Cell membrane. Membrane, coated pit Peripheral membrane protein Cytoplasmic side. Component of the coat surrounding the cytoplasmic face of the plasma membrane coated vesicles. |
|
Protein Description | Component of the adaptor complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration.. | |
Protein Sequence | MAVQFILCFNKQGVVRLVRWFDVHSSDPQRSQDAIAQIYRLISSRDHKHQSNFVEFSDSTKLIYRRYAGLYFVMGVDLLDDEPIYLCHIHLFVEVLDAFFGNVCELDIVFNFYKVYMIMDEMFIGGEIQEISKDMLLERLSILDRLD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of AP2S_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AP2S_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AP2S_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AP2S_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AP2B_YEAST | APL1 | physical | 16554755 | |
AP2M_YEAST | APM4 | physical | 16554755 | |
AP2A_YEAST | APL3 | physical | 18719252 | |
COM1_YEAST | SAE2 | physical | 18719252 | |
LTE1_YEAST | LTE1 | genetic | 20093466 | |
MTU1_YEAST | SLM3 | genetic | 20093466 | |
ZRT1_YEAST | ZRT1 | genetic | 20093466 | |
MAN1_YEAST | AMS1 | genetic | 20093466 | |
KA122_YEAST | KAP122 | genetic | 20093466 | |
PEF1_YEAST | PEF1 | genetic | 20093466 | |
SOL4_YEAST | SOL4 | genetic | 20093466 | |
YRA2_YEAST | YRA2 | genetic | 20093466 | |
RL14A_YEAST | RPL14A | genetic | 20093466 | |
UTH1_YEAST | UTH1 | genetic | 20093466 | |
YL040_YEAST | AFB1 | genetic | 20093466 | |
SHH4_YEAST | SHH4 | genetic | 20093466 | |
ERG2_YEAST | ERG2 | genetic | 20093466 | |
ATP23_YEAST | ATP23 | genetic | 20093466 | |
TCO89_YEAST | TCO89 | genetic | 20093466 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...