| UniProt ID | AP2S_YEAST | |
|---|---|---|
| UniProt AC | Q00381 | |
| Protein Name | AP-2 complex subunit sigma | |
| Gene Name | APS2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 147 | |
| Subcellular Localization |
Cell membrane. Membrane, coated pit Peripheral membrane protein Cytoplasmic side. Component of the coat surrounding the cytoplasmic face of the plasma membrane coated vesicles. |
|
| Protein Description | Component of the adaptor complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration.. | |
| Protein Sequence | MAVQFILCFNKQGVVRLVRWFDVHSSDPQRSQDAIAQIYRLISSRDHKHQSNFVEFSDSTKLIYRRYAGLYFVMGVDLLDDEPIYLCHIHLFVEVLDAFFGNVCELDIVFNFYKVYMIMDEMFIGGEIQEISKDMLLERLSILDRLD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of AP2S_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AP2S_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AP2S_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AP2S_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| AP2B_YEAST | APL1 | physical | 16554755 | |
| AP2M_YEAST | APM4 | physical | 16554755 | |
| AP2A_YEAST | APL3 | physical | 18719252 | |
| COM1_YEAST | SAE2 | physical | 18719252 | |
| LTE1_YEAST | LTE1 | genetic | 20093466 | |
| MTU1_YEAST | SLM3 | genetic | 20093466 | |
| ZRT1_YEAST | ZRT1 | genetic | 20093466 | |
| MAN1_YEAST | AMS1 | genetic | 20093466 | |
| KA122_YEAST | KAP122 | genetic | 20093466 | |
| PEF1_YEAST | PEF1 | genetic | 20093466 | |
| SOL4_YEAST | SOL4 | genetic | 20093466 | |
| YRA2_YEAST | YRA2 | genetic | 20093466 | |
| RL14A_YEAST | RPL14A | genetic | 20093466 | |
| UTH1_YEAST | UTH1 | genetic | 20093466 | |
| YL040_YEAST | AFB1 | genetic | 20093466 | |
| SHH4_YEAST | SHH4 | genetic | 20093466 | |
| ERG2_YEAST | ERG2 | genetic | 20093466 | |
| ATP23_YEAST | ATP23 | genetic | 20093466 | |
| TCO89_YEAST | TCO89 | genetic | 20093466 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
