| UniProt ID | NOP19_YEAST | |
|---|---|---|
| UniProt AC | P53317 | |
| Protein Name | Nucleolar protein 19 | |
| Gene Name | NOP19 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 196 | |
| Subcellular Localization | Nucleus, nucleolus . | |
| Protein Description | Ribosome biogenesis factor required for cleavage of pre-rRNA at A0, A1 and A2 sites. Essential for the incorporation of UTP25 in pre-ribosomes.. | |
| Protein Sequence | MSRAKELQEKLNLQAKLQSTFSNNTAAVLDWLKESDETGISNDTERNKQLKDHKELEDGKKAFFKLPVLQIGSGLHFRTQDDASAKEDIHTIGEFIEGDKKVSSLAKKKKRSDPGLQRNNMYRITKDDTKAMIALKRKMRKGEKEGLRKKQEHSKSSVSNSYSASDEEDEDAGTMPQKSTKKKFGLLFDKKKKARK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 73 | Phosphorylation | LPVLQIGSGLHFRTQ CCEEEECCCEEECCC | 22369663 | ||
| 103 | Phosphorylation | IEGDKKVSSLAKKKK HHCCHHHHHHHHHHC | 28889911 | ||
| 104 | Phosphorylation | EGDKKVSSLAKKKKR HCCHHHHHHHHHHCC | 28889911 | ||
| 112 | Phosphorylation | LAKKKKRSDPGLQRN HHHHHCCCCCCCCCC | 28889911 | ||
| 156 | Phosphorylation | KKQEHSKSSVSNSYS HHHHHCCHHCCCCCC | 23749301 | ||
| 157 | Phosphorylation | KQEHSKSSVSNSYSA HHHHCCHHCCCCCCC | 28889911 | ||
| 159 | Phosphorylation | EHSKSSVSNSYSASD HHCCHHCCCCCCCCC | 28889911 | ||
| 161 | Phosphorylation | SKSSVSNSYSASDEE CCHHCCCCCCCCCCC | 28889911 | ||
| 162 | Phosphorylation | KSSVSNSYSASDEED CHHCCCCCCCCCCCC | 20377248 | ||
| 163 | Phosphorylation | SSVSNSYSASDEEDE HHCCCCCCCCCCCCC | 19823750 | ||
| 165 | Phosphorylation | VSNSYSASDEEDEDA CCCCCCCCCCCCCCC | 19823750 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NOP19_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NOP19_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NOP19_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
