UniProt ID | YE19_YEAST | |
---|---|---|
UniProt AC | P40104 | |
Protein Name | Uncharacterized protein YER189W | |
Gene Name | YER189W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 122 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MKVSDRRKFEKANFDEFESALNNKNDLVHCPSITLFESIPTEVRSFYEDEKSGLIKVVKFRTGAMDRKRSFEKIVISVMVGKNVQKFLTFVEDEPDFQGGPIPSNKPRDGLHVVSSAYFEIQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YE19_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YE19_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YE19_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SYIC_YEAST | ILS1 | genetic | 27708008 | |
PRP9_YEAST | PRP9 | genetic | 27708008 | |
NOP14_YEAST | NOP14 | genetic | 27708008 | |
TAF12_YEAST | TAF12 | genetic | 27708008 | |
UTP6_YEAST | UTP6 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
STT3_YEAST | STT3 | genetic | 27708008 | |
CDC20_YEAST | CDC20 | genetic | 27708008 | |
SWC4_YEAST | SWC4 | genetic | 27708008 | |
RRP4_YEAST | RRP4 | genetic | 27708008 | |
ARP4_YEAST | ARP4 | genetic | 27708008 | |
DPB11_YEAST | DPB11 | genetic | 27708008 | |
SEC22_YEAST | SEC22 | genetic | 27708008 | |
RU1C_YEAST | YHC1 | genetic | 27708008 | |
TAD3_YEAST | TAD3 | genetic | 27708008 | |
MCM1_YEAST | MCM1 | genetic | 27708008 | |
NOP2_YEAST | NOP2 | genetic | 27708008 | |
DPOA_YEAST | POL1 | genetic | 27708008 | |
DCP2_YEAST | DCP2 | genetic | 27708008 | |
SPC98_YEAST | SPC98 | genetic | 27708008 | |
NAT10_YEAST | KRE33 | genetic | 27708008 | |
NAB3_YEAST | NAB3 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...