| UniProt ID | YP038_YEAST | |
|---|---|---|
| UniProt AC | Q3E7B4 | |
| Protein Name | Uncharacterized protein YPL038W-A | |
| Gene Name | YPL038W-A | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 63 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MVCRFVHHSRVIFISIYDFLSTKGKKNMYNYTQEKKTKQKNTFTQASIYYENFFESYRTISCL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Phosphorylation | VCRFVHHSRVIFISI CCCCCCCCEEEEEEH | 17.23 | 28889911 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YP038_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YP038_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YP038_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SYIC_YEAST | ILS1 | genetic | 27708008 | |
| UBC3_YEAST | CDC34 | genetic | 27708008 | |
| TAF12_YEAST | TAF12 | genetic | 27708008 | |
| MOB2_YEAST | MOB2 | genetic | 27708008 | |
| SWC4_YEAST | SWC4 | genetic | 27708008 | |
| ARP4_YEAST | ARP4 | genetic | 27708008 | |
| SEC17_YEAST | SEC17 | genetic | 27708008 | |
| APC11_YEAST | APC11 | genetic | 27708008 | |
| NSE4_YEAST | NSE4 | genetic | 27708008 | |
| PDC2_YEAST | PDC2 | genetic | 27708008 | |
| TFB1_YEAST | TFB1 | genetic | 27708008 | |
| RPB7_YEAST | RPB7 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| STT3_YEAST | STT3 | genetic | 27708008 | |
| SYMC_YEAST | MES1 | genetic | 27708008 | |
| CDC12_YEAST | CDC12 | genetic | 27708008 | |
| MET30_YEAST | MET30 | genetic | 27708008 | |
| KTHY_YEAST | CDC8 | genetic | 27708008 | |
| FIP1_YEAST | FIP1 | genetic | 27708008 | |
| RSC9_YEAST | RSC9 | genetic | 27708008 | |
| CBF3B_YEAST | CEP3 | genetic | 27708008 | |
| DPOA_YEAST | POL1 | genetic | 27708008 | |
| TYSY_YEAST | CDC21 | genetic | 27708008 | |
| RPB2_YEAST | RPB2 | genetic | 27708008 | |
| MED4_YEAST | MED4 | genetic | 27708008 | |
| DYR_YEAST | DFR1 | genetic | 27708008 | |
| APC5_YEAST | APC5 | genetic | 27708008 | |
| CLP1_YEAST | CLP1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...