UniProt ID | YP038_YEAST | |
---|---|---|
UniProt AC | Q3E7B4 | |
Protein Name | Uncharacterized protein YPL038W-A | |
Gene Name | YPL038W-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 63 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MVCRFVHHSRVIFISIYDFLSTKGKKNMYNYTQEKKTKQKNTFTQASIYYENFFESYRTISCL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | VCRFVHHSRVIFISI CCCCCCCCEEEEEEH | 17.23 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YP038_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YP038_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YP038_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SYIC_YEAST | ILS1 | genetic | 27708008 | |
UBC3_YEAST | CDC34 | genetic | 27708008 | |
TAF12_YEAST | TAF12 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
SWC4_YEAST | SWC4 | genetic | 27708008 | |
ARP4_YEAST | ARP4 | genetic | 27708008 | |
SEC17_YEAST | SEC17 | genetic | 27708008 | |
APC11_YEAST | APC11 | genetic | 27708008 | |
NSE4_YEAST | NSE4 | genetic | 27708008 | |
PDC2_YEAST | PDC2 | genetic | 27708008 | |
TFB1_YEAST | TFB1 | genetic | 27708008 | |
RPB7_YEAST | RPB7 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
STT3_YEAST | STT3 | genetic | 27708008 | |
SYMC_YEAST | MES1 | genetic | 27708008 | |
CDC12_YEAST | CDC12 | genetic | 27708008 | |
MET30_YEAST | MET30 | genetic | 27708008 | |
KTHY_YEAST | CDC8 | genetic | 27708008 | |
FIP1_YEAST | FIP1 | genetic | 27708008 | |
RSC9_YEAST | RSC9 | genetic | 27708008 | |
CBF3B_YEAST | CEP3 | genetic | 27708008 | |
DPOA_YEAST | POL1 | genetic | 27708008 | |
TYSY_YEAST | CDC21 | genetic | 27708008 | |
RPB2_YEAST | RPB2 | genetic | 27708008 | |
MED4_YEAST | MED4 | genetic | 27708008 | |
DYR_YEAST | DFR1 | genetic | 27708008 | |
APC5_YEAST | APC5 | genetic | 27708008 | |
CLP1_YEAST | CLP1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...