YD34A_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YD34A_YEAST
• UniProt AC: P0C289
• Protein Name: Putative uncharacterized protein YDR034C-A
• Gene Name: YDR034C-A
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 58
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MESIFLHANITIIPHSVLYVSLSYYIINPCVSVSTNLDDYFSSFVSSSNTVYDNILVT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YD34A_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YD34A_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YD34A_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YD34A_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TYSY_YEAST	CDC21	genetic	27708008
DPOA2_YEAST	POL12	genetic	27708008
TRS20_YEAST	TRS20	genetic	27708008
UTP5_YEAST	UTP5	genetic	27708008
MED6_YEAST	MED6	genetic	27708008
NOP56_YEAST	NOP56	genetic	27708008
LIP1_YEAST	LIP1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.