UniProt ID | MGDP1_YEAST | |
---|---|---|
UniProt AC | P40081 | |
Protein Name | Putative magnesium-dependent phosphatase YER134C | |
Gene Name | YER134C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 178 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Magnesium-dependent phosphatase which may act as a tyrosine phosphatase.. | |
Protein Sequence | MTGYPDVAAFDLDYTIWPCYCDTHLHGPFKPVKSSNGEVLTIICRDGYELTIYKDIPRILGDLKDNGVKLMTASRTWAPEIAQEILKIFKVKYAGVVTPLANLFDEFQWGERSKIGHLRDGLKDLYNTSDLKSKKICLFDDESRNKEVEKYGVKFVYVRDPENGPSWKLYQDYLSGKV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Phosphorylation | SSNGEVLTIICRDGY CCCCCEEEEEECCCE | 17.30 | 28889911 | |
64 | Acetylation | PRILGDLKDNGVKLM HHHHHCHHHCCEEEE | 54.62 | 25381059 | |
64 | Succinylation | PRILGDLKDNGVKLM HHHHHCHHHCCEEEE | 54.62 | 23954790 | |
123 | Acetylation | GHLRDGLKDLYNTSD CHHHHHHHHHHCCCC | 51.74 | 24489116 | |
123 | Succinylation | GHLRDGLKDLYNTSD CHHHHHHHHHHCCCC | 51.74 | 23954790 | |
132 | Succinylation | LYNTSDLKSKKICLF HHCCCCCCCCEEEEE | 66.28 | 23954790 | |
151 | Phosphorylation | RNKEVEKYGVKFVYV HCHHHHHHCEEEEEE | 17.41 | 22369663 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MGDP1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MGDP1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MGDP1_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-41, AND MASSSPECTROMETRY. |