dbPTM

YI002_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YI002_YEAST
UniProt AC	Q3E7Z5
Protein Name	Uncharacterized protein YIL002W-A
Gene Name	YIL002W-A
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	69
Subcellular Localization
Protein Description
Protein Sequence	MTRDTPEDVSTAGAKDILDVLNLLKGGEEKISEVELKLDEMEKKMDSLLVQLEDLHRDNNDLAKSSSQK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTRDTPEDV ------CCCCCHHHH	36.93	28889911
5	Phosphorylation	---MTRDTPEDVSTA ---CCCCCHHHHHHC	25.86	22369663
10	Phosphorylation	RDTPEDVSTAGAKDI CCCHHHHHHCCHHHH	25.51	28132839
11	Phosphorylation	DTPEDVSTAGAKDIL CCHHHHHHCCHHHHH	29.03	22369663
25	Ubiquitination	LDVLNLLKGGEEKIS HHHHHHHHCCCHHHH	68.95	24961812
25	Acetylation	LDVLNLLKGGEEKIS HHHHHHHHCCCHHHH	68.95	24489116
32	Phosphorylation	KGGEEKISEVELKLD HCCCHHHHHHHHHHH	46.81	28889911
43	Acetylation	LKLDEMEKKMDSLLV HHHHHHHHHHHHHHH	52.68	24489116
64	Acetylation	RDNNDLAKSSSQK-- HCCCHHHHHHCCC--	59.16	25381059

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YI002_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YI002_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YI002_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HPH2_YEAST	FRT2	physical	22875988
SPC72_YEAST	SPC72	physical	22875988
FIN1_YEAST	FIN1	physical	22875988
NBP1_YEAST	NBP1	physical	22875988
YRA2_YEAST	YRA2	genetic	27708008
YM14_YEAST	YMR130W	genetic	27708008
DGK1_YEAST	DGK1	genetic	27708008
SHG1_YEAST	SHG1	genetic	27708008
YCQ6_YEAST	YCR016W	genetic	27708008
SNT1_YEAST	SNT1	genetic	27708008
ATG15_YEAST	ATG15	genetic	27708008
IPT1_YEAST	IPT1	genetic	27708008
PP4C_YEAST	PPH3	genetic	27708008
VPS41_YEAST	VPS41	genetic	27708008
FOB1_YEAST	FOB1	genetic	27708008
SGF73_YEAST	SGF73	genetic	27708008
HOS2_YEAST	HOS2	genetic	27708008
VAM7_YEAST	VAM7	genetic	27708008
RS25A_YEAST	RPS25A	genetic	27708008
RL8A_YEAST	RPL8A	genetic	27708008
MED20_YEAST	SRB2	genetic	27708008
STB5_YEAST	STB5	genetic	27708008
PTH_YEAST	PTH1	genetic	27708008
AIM18_YEAST	AIM18	genetic	27708008
YJY1_YEAST	YJR011C	genetic	27708008
DHOM_YEAST	HOM6	genetic	27708008
RM49_YEAST	MRP49	genetic	27708008
SET3_YEAST	SET3	genetic	27708008
NAP1_YEAST	NAP1	genetic	27708008
PAM17_YEAST	PAM17	genetic	27708008
HOG1_YEAST	HOG1	genetic	27708008
MMR1_YEAST	MMR1	genetic	27708008
VID22_YEAST	VID22	genetic	27708008
RM39_YEAST	MRPL39	genetic	27708008
SKY1_YEAST	SKY1	genetic	27708008
SAP30_YEAST	SAP30	genetic	27708008
HRB1_YEAST	HRB1	genetic	27708008
YO036_YEAST	YOL036W	genetic	27708008
PT127_YEAST	PET127	genetic	27708008
CY1_YEAST	CYT1	genetic	27708008
RDL2_YEAST	RDL2	genetic	27708008
MSC6_YEAST	MSC6	genetic	27708008
RAD1_YEAST	RAD1	genetic	27708008
TRM44_YEAST	TRM44	genetic	27708008
FMP30_YEAST	FMP30	genetic	27708008
PET20_YEAST	PET20	genetic	27708008
CTI6_YEAST	CTI6	genetic	27708008
SRO7_YEAST	SRO7	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YI002_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-5, AND MASSSPECTROMETRY.	18407956 [Abstract]