YK018_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YK018_YEAST
• UniProt AC: Q3E7A7
• Protein Name: Uncharacterized protein YKL018C-A
• Gene Name: YKL018C-A
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 99
• Subcellular Localization: Cytoplasm .
• Protein Sequence: MLGMIRWVVEGTLVAMLLSAIRRETGMIFFYNQYQLGGWIHRYLSWGEMCYTRTLKMVKRSKFFRKQLNEDGFGRINDSGPKRRGRDQSQYSSRFVELD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
79	Phosphorylation	GFGRINDSGPKRRGR CCCCCCCCCCCCCCC	53.13	27214570

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YK018_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YK018_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YK018_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDC1_YEAST	CDC1	genetic	27708008
COG3_YEAST	COG3	genetic	27708008
SYIC_YEAST	ILS1	genetic	27708008
GLE1_YEAST	GLE1	genetic	27708008
TIM22_YEAST	TIM22	genetic	27708008
TFB1_YEAST	TFB1	genetic	27708008
RPB7_YEAST	RPB7	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
NU145_YEAST	NUP145	genetic	27708008
PGTB1_YEAST	CDC43	genetic	27708008
MED6_YEAST	MED6	genetic	27708008
NU192_YEAST	NUP192	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
PRP24_YEAST	PRP24	genetic	27708008
TIM23_YEAST	TIM23	genetic	27708008
RPAB3_YEAST	RPB8	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.