| UniProt ID | RASK_HUMAN | |
|---|---|---|
| UniProt AC | P01116 | |
| Protein Name | GTPase KRas | |
| Gene Name | KRAS | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 189 | |
| Subcellular Localization |
Cell membrane Lipid-anchor Cytoplasmic side . Cytoplasm, cytosol . |
|
| Protein Description | Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation. [PubMed: 23698361] | |
| Protein Sequence | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCIIM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MTEYKLVV -------CCCEEEEE | 6.07 | - | |
| 2 | Acetylation | ------MTEYKLVVV ------CCCEEEEEE | 48.28 | - | |
| 2 | Phosphorylation | ------MTEYKLVVV ------CCCEEEEEE | 48.28 | 19690332 | |
| 4 | Phosphorylation | ----MTEYKLVVVGA ----CCCEEEEEECC | 10.64 | 19690332 | |
| 32 | Phosphorylation | QNHFVDEYDPTIEDS HHHCCCCCCCCCCHH | 23.82 | 25884760 | |
| 35 | Phosphorylation | FVDEYDPTIEDSYRK CCCCCCCCCCHHHCC | 33.82 | 28348404 | |
| 35 | O-linked_Glycosylation | FVDEYDPTIEDSYRK CCCCCCCCCCHHHCC | 33.82 | 19744486 | |
| 39 | Phosphorylation | YDPTIEDSYRKQVVI CCCCCCHHHCCEEEE | 17.66 | 23401153 | |
| 40 | Phosphorylation | DPTIEDSYRKQVVID CCCCCHHHCCEEEEC | 33.86 | 23403867 | |
| 64 | Phosphorylation | DTAGQEEYSAMRDQY HHCCHHHHHHHHHHH | 10.85 | 22322096 | |
| 65 | Phosphorylation | TAGQEEYSAMRDQYM HCCHHHHHHHHHHHH | 20.90 | 28796482 | |
| 89 | Phosphorylation | FAINNTKSFEDIHHY EEECCCCCHHHHHHH | 31.65 | - | |
| 96 | Phosphorylation | SFEDIHHYREQIKRV CHHHHHHHHHHHHCC | 11.15 | - | |
| 101 | Acetylation | HHYREQIKRVKDSED HHHHHHHHCCCCCCC | 51.32 | 112847399 | |
| 104 | Acetylation | REQIKRVKDSEDVPM HHHHHCCCCCCCCCE | 60.62 | 22711838 | |
| 104 (in isoform 2) | Acetylation | - | 60.62 | - | |
| 104 | Ubiquitination | REQIKRVKDSEDVPM HHHHHCCCCCCCCCE | 60.62 | 22711838 | |
| 106 | Phosphorylation | QIKRVKDSEDVPMVL HHHCCCCCCCCCEEE | 29.94 | 20860994 | |
| 117 | Ubiquitination | PMVLVGNKCDLPSRT CEEEECCCCCCCCCC | 24.17 | - | |
| 118 | S-nitrosocysteine | MVLVGNKCDLPSRTV EEEECCCCCCCCCCC | 8.24 | - | |
| 128 | Acetylation | PSRTVDTKQAQDLAR CCCCCCHHHHHHHHH | 38.89 | 112847401 | |
| 128 | Ubiquitination | PSRTVDTKQAQDLAR CCCCCCHHHHHHHHH | 38.89 | 21890473 | |
| 128 (in isoform 2) | Ubiquitination | - | 38.89 | 21890473 | |
| 128 (in isoform 1) | Ubiquitination | - | 38.89 | 21890473 | |
| 128 | Ubiquitination | PSRTVDTKQAQDLAR CCCCCCHHHHHHHHH | 38.89 | 21890473 | |
| 136 | Phosphorylation | QAQDLARSYGIPFIE HHHHHHHHHCCCEEE | 23.31 | 28152594 | |
| 137 | Phosphorylation | AQDLARSYGIPFIET HHHHHHHHCCCEEEC | 17.33 | 28152594 | |
| 144 | Phosphorylation | YGIPFIETSAKTRQR HCCCEEECCHHHHHH | 29.21 | - | |
| 147 (in isoform 2) | Ubiquitination | - | 43.96 | 21890473 | |
| 147 (in isoform 1) | Ubiquitination | - | 43.96 | 21890473 | |
| 147 | Ubiquitination | PFIETSAKTRQRVED CEEECCHHHHHHHHH | 43.96 | 2190698 | |
| 147 | Acetylation | PFIETSAKTRQRVED CEEECCHHHHHHHHH | 43.96 | 112847403 | |
| 148 (in isoform 2) | Phosphorylation | - | 31.58 | - | |
| 148 | Phosphorylation | FIETSAKTRQRVEDA EEECCHHHHHHHHHH | 31.58 | - | |
| 157 (in isoform 2) | Phosphorylation | - | 10.82 | - | |
| 157 | Phosphorylation | QRVEDAFYTLVREIR HHHHHHHHHHHHHHH | 10.82 | - | |
| 158 (in isoform 2) | Phosphorylation | - | 16.60 | - | |
| 172 | Phosphorylation | QYRLKKISKEEKTPG HHHHHHCCCCCCCCC | 42.78 | 23532336 | |
| 177 | Phosphorylation | KISKEEKTPGCVKIK HCCCCCCCCCCEEEE | 28.35 | 23403867 | |
| 180 | S-palmitoylation | KEEKTPGCVKIKKCI CCCCCCCCEEEEEEE | 2.72 | - | |
| 181 (in isoform 2) | Phosphorylation | - | 9.96 | - | |
| 186 | Farnesylation | GCVKIKKCIIM---- CCEEEEEEEEC---- | 1.85 | 27791178 | |
| 186 | Farnesylation | GCVKIKKCIIM---- CCEEEEEEEEC---- | 1.85 | 27791178 | |
| 186 | Methylation | GCVKIKKCIIM---- CCEEEEEEEEC---- | 1.85 | 27791178 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 32 | Y | Phosphorylation | Kinase | SRC | P12931 | PSP |
| 64 | Y | Phosphorylation | Kinase | SRC | P12931 | PSP |
| 181 | S | Phosphorylation | Kinase | PRKCA | P17252 | GPS |
| 181 | S | Phosphorylation | Kinase | PRKCQ | Q04759 | GPS |
| - | K | Ubiquitination | E3 ubiquitin ligase | NEDD4 | P46934 | PMID:24746824 |
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RASK_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| H00003 | Acute myeloid leukemia (AML) | |||||
| H00010 | Multiple myeloma | |||||
| H00014 | Non-small cell lung cancer | |||||
| H00016 | Oral cancer | |||||
| H00018 | Gastric cancer | |||||
| H00019 | Pancreatic cancer | |||||
| H00020 | Colorectal cancer | |||||
| H00026 | Endometrial Cancer | |||||
| H00027 | Ovarian cancer | |||||
| H00030 | Cervical cancer | |||||
| H00032 | Thyroid cancer | |||||
| H00040 | Squamous cell carcinoma | |||||
| H00041 | Kaposi's sarcoma | |||||
| H00046 | Cholangiocarcinoma | |||||
| H00047 | Gallbladder cancer | |||||
| H00048 | Hepatocellular carcinoma | |||||
| H00458 | Craniosynostosis, including: Pfeiffer syndrome; Apert syndrome; Crouzon syndrome; Jackson-Weiss synd | |||||
| H00523 | Noonan syndrome and related disorders, including: Noonan syndrome (NS); Leopard syndrome (LS); Noona | |||||
| OMIM Disease | ||||||
| 601626 | Leukemia, acute myelogenous (AML) | |||||
| 607785 | Leukemia, juvenile myelomonocytic (JMML) | |||||
| 609942 | Noonan syndrome 3 (NS3) | |||||
| 613659 | Gastric cancer (GASC) | |||||
| Note=Defects in KRAS are a cause of pylocytic astrocytoma (PA). Pylocytic astrocytomas are neoplasms of the brain and spinal cord derived from glial cells which vary from histologically benign forms to highly anaplastic and malignant tumors. | ||||||
| 615278 | ||||||
| Kegg Drug | ||||||
| D03455 | Cetuximab (genetical recombination) (JAN); Cetuximab (USAN/INN); Erbitux (TN) | |||||
| D05350 | Panitumumab (genetical recombination) (JAN); Panitumumab (USAN/INN); Vectibix (TN) | |||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...