| UniProt ID | RGP1_HUMAN | |
|---|---|---|
| UniProt AC | Q92546 | |
| Protein Name | RAB6A-GEF complex partner protein 2 {ECO:0000305} | |
| Gene Name | RGP1 {ECO:0000312|HGNC:HGNC:21965} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 391 | |
| Subcellular Localization | Cytoplasm, cytosol . Membrane . | |
| Protein Description | The RIC1-RGP1 complex acts as a guanine nucleotide exchange factor (GEF), which activates RAB6A by exchanging bound GDP for free GTP and may thereby required for efficient fusion of endosome-derived vesicles with the Golgi compartment. The RIC1-RGP1 complex participates in the recycling of mannose-6-phosphate receptors.. | |
| Protein Sequence | MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPSVSHVTHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTWTGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 97 | Ubiquitination | CILSTPPKILFCDLR EEECCCCEEEEEECC | 53.93 | - | |
| 111 | Ubiquitination | RLDPGESKSYSYSEV CCCCCCCCCCCCCCE | 49.46 | 21906983 | |
| 134 | Phosphorylation | FRGQSVKYVYKLTIG CCCCCCEEEEEEEEC | 13.57 | 25884760 | |
| 151 | Ubiquitination | RVNSPITLLRVPLRV ECCCCEEEEECCEEE | 2.73 | 21906983 | |
| 178 | Phosphorylation | QDEAVAPSSPFLEED CCCCCCCCCCCCCCC | 40.69 | 23090842 | |
| 179 | Phosphorylation | DEAVAPSSPFLEEDE CCCCCCCCCCCCCCC | 20.72 | 25850435 | |
| 189 | Ubiquitination | LEEDEGGKKDSWLAE CCCCCCCCCCCHHHH | 65.35 | 21906983 | |
| 190 | Ubiquitination | EEDEGGKKDSWLAEL CCCCCCCCCCHHHHH | 61.34 | 1906983 | |
| 192 | Phosphorylation | DEGGKKDSWLAELAG CCCCCCCCHHHHHHH | 32.63 | - | |
| 210 | Phosphorylation | MAATSCRSLHLYNIS HHHHHCCEEEEEECC | 25.19 | 28348404 | |
| 229 | Ubiquitination | KVGTFGIFKSVYRLG CEEHHHHHHHHEECC | 5.02 | 21906983 | |
| 230 | Ubiquitination | VGTFGIFKSVYRLGE EEHHHHHHHHEECCC | 36.77 | 21906983 | |
| 233 | Phosphorylation | FGIFKSVYRLGEDVV HHHHHHHEECCCCEE | 13.76 | - | |
| 285 | Phosphorylation | VPSVSHVTHARHQES CCCCHHHCCCCCCHH | 12.37 | - | |
| 372 | Phosphorylation | LPIKVLPTSPTLASY CEEEEECCCCCCHHH | 43.08 | 28348404 | |
| 373 | Phosphorylation | PIKVLPTSPTLASYA EEEEECCCCCCHHHC | 17.59 | 28348404 | |
| 375 | Phosphorylation | KVLPTSPTLASYAAP EEECCCCCCHHHCCC | 34.42 | 28348404 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RGP1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RGP1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RGP1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
