| UniProt ID | SPAC7_HUMAN | |
|---|---|---|
| UniProt AC | Q96KW9 | |
| Protein Name | Sperm acrosome-associated protein 7 {ECO:0000312|HGNC:HGNC:29575} | |
| Gene Name | SPACA7 {ECO:0000312|HGNC:HGNC:29575} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 195 | |
| Subcellular Localization | Secreted . Cytoplasmic vesicle, secretory vesicle, acrosome . Cytoplasmic vesicle, secretory vesicle, acrosome lumen . Localized in perinuclear pro-acrosomal granules in round spermatides. Localized between the inner and outer acrosomal membranes (ma | |
| Protein Description | Involved in fertilization. Seems not to play a direct role in sperm-egg binding or gamete fusion.. | |
| Protein Sequence | MAVSQGDGTLCFVLLLCCWQETELRPRTVIPGSPTEIPFSSKQEDMSELLDEILVQEILDLNKTTPSEMPSTASTLSTPLHAGIDENYQAGGSENYHELLENLQFSPGIEVKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQYENLSILDQILQNIGRSSGNIFHKEQQRTSAQRRSQGSQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 62 | N-linked_Glycosylation | VQEILDLNKTTPSEM HHHHHHHCCCCCCCC | 39.02 | UniProtKB CARBOHYD | |
| 144 | Phosphorylation | VSPGSEKSVSSKEKN CCCCCCCCCCCCCCC | 24.15 | - | |
| 157 | Phosphorylation | KNSKNTQYENLSILD CCCCCCHHHHHHHHH | 12.54 | - | |
| 159 | N-linked_Glycosylation | SKNTQYENLSILDQI CCCCHHHHHHHHHHH | 33.87 | UniProtKB CARBOHYD | |
| 174 | Phosphorylation | LQNIGRSSGNIFHKE HHHHCCCCCCCCCHH | 34.20 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPAC7_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPAC7_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPAC7_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SPAC7_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...