UniProt ID | LRC10_HUMAN | |
---|---|---|
UniProt AC | Q5BKY1 | |
Protein Name | Leucine-rich repeat-containing protein 10 | |
Gene Name | LRRC10 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 277 | |
Subcellular Localization | Nucleus. | |
Protein Description | May play important roles in cardiac development and/or cardiac function.. | |
Protein Sequence | MGNTIRALVAFIPADRCQNYVVRDLREMPLDKMVDLSGSQLRRFPLHVCSFRELVKLYLSDNHLNSLPPELGQLQNLQILALDFNNFKALPQVVCTLKQLCILYLGNNKLCDLPSELSLLQNLRTLWIEANCLTQLPDVVCELSLLKTLHAGSNALRLLPGQLRRLQELRTIWLSGNRLTDFPTVLLHMPFLEVIDVDWNSIRYFPSLAHLSSLKLVIYDHNPCRNAPKVAKGVRRVGRWAEETPEPDPRKARRYALVREESQELQAPVPLLPPTNS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MGNTIRALVAF ----CCCCHHHHHEE | 13.20 | 24719451 | |
20 | Phosphorylation | PADRCQNYVVRDLRE CHHHHCCHHHCHHHH | 3.72 | 24719451 | |
144 | Phosphorylation | PDVVCELSLLKTLHA CHHHHHHHHHHHHHC | 14.90 | 24719451 | |
212 | Phosphorylation | FPSLAHLSSLKLVIY CCCHHHHHCCEEEEE | 24.61 | 24719451 | |
255 | Phosphorylation | DPRKARRYALVREES CHHHHHHHHHHHHHH | 9.95 | - | |
262 | Phosphorylation | YALVREESQELQAPV HHHHHHHHHHCCCCC | 24.97 | 26699800 | |
275 | Phosphorylation | PVPLLPPTNS----- CCCCCCCCCC----- | 46.27 | 26699800 | |
277 | Phosphorylation | PLLPPTNS------- CCCCCCCC------- | 44.04 | 26699800 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LRC10_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LRC10_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LRC10_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ENOF1_HUMAN | ENOSF1 | physical | 28514442 | |
TCPW_HUMAN | CCT6B | physical | 28514442 | |
SGT1_HUMAN | SUGT1 | physical | 28514442 | |
RHG08_HUMAN | ARHGAP8 | physical | 28514442 | |
TCPB_HUMAN | CCT2 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...