| UniProt ID | CAH12_HUMAN | |
|---|---|---|
| UniProt AC | O43570 | |
| Protein Name | Carbonic anhydrase 12 | |
| Gene Name | CA12 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 354 | |
| Subcellular Localization |
Membrane Single-pass type I membrane protein. |
|
| Protein Description | Reversible hydration of carbon dioxide.. | |
| Protein Sequence | MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 28 | N-linked_Glycosylation | PSSPAPVNGSKWTYF CCCCCCCCCCCCEEE | 48.22 | UniProtKB CARBOHYD | |
| 80 | N-linked_Glycosylation | PLEFQGYNLSANKQF CEEECCEECCCCCEE | 34.05 | UniProtKB CARBOHYD | |
| 162 | N-linked_Glycosylation | PDASTASNKSEGLAV CCCCCCCCHHHHHHH | 49.78 | UniProtKB CARBOHYD | |
| 194 | Acetylation | FSHLQHVKYKGQEAF HHHHHHCEECCCEEE | 38.84 | 25825284 | |
| 336 (in isoform 2) | Ubiquitination | - | 63.65 | - | |
| 342 | Phosphorylation | GDNKGVIYKPATKME CCCCCCEECCCCCCC | 14.44 | 22817900 | |
| 343 | Ubiquitination | DNKGVIYKPATKMET CCCCCEECCCCCCCC | 19.63 | - | |
| 346 | Phosphorylation | GVIYKPATKMETEAH CCEECCCCCCCCCCC | 39.18 | 28857561 | |
| 347 | Ubiquitination | VIYKPATKMETEAHA CEECCCCCCCCCCCC | 36.52 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CAH12_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CAH12_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CAH12_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CAH12_HUMAN | CA12 | physical | 11493685 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| H00021 | Renal cell carcinoma | |||||
| H01302 | Hyperchlorhidrosis isolated (HCHLH) | |||||
| OMIM Disease | ||||||
| 143860 | Hyperchlorhidrosis, isolated (HCHLH) | |||||
| Kegg Drug | ||||||
| D00218 | Acetazolamide (JP16/USP/INN); Diamox (TN) | |||||
| D00219 | Acetohexamide (JP16/USP/INN); Dymelor (TN) | |||||
| D00518 | Diclofenamide (JP16/INN); Dichlorphenamide (USP); Daranide (TN) | |||||
| D00652 | Brinzolamide (JAN/USP/INN); Azopt (TN) | |||||
| D00653 | Dorzolamide hydrochloride (JP16/USP); Trusopt (TN) | |||||
| D00655 | Methazolamide (JAN/USP/INN); Neptazane (TN) | |||||
| D01196 | Acetazolamide sodium (JAN); Diamox (TN) | |||||
| D01822 | Clofenamide (JAN/INN) | |||||
| D02441 | Ethoxzolamide; Cardrase (TN) | |||||
| D03845 | Sezolamide hydrochloride (USAN) | |||||
| D07871 | Dorzolamide (INN); Trusopt (TN) | |||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
