UniProt ID | IL24_HUMAN | |
---|---|---|
UniProt AC | Q13007 | |
Protein Name | Interleukin-24 | |
Gene Name | IL24 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 206 | |
Subcellular Localization | Secreted . | |
Protein Description | Has antiproliferative properties on melanoma cells and may contribute to terminal cell differentiation.. | |
Protein Sequence | MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
63 (in isoform 4) | Phosphorylation | - | 27.14 | - | |
85 | N-linked_Glycosylation | DTMQAQDNITSARLL HHHHHHHCHHHHHHH | 27.62 | UniProtKB CARBOHYD | |
88 | Phosphorylation | QAQDNITSARLLQQE HHHHCHHHHHHHHHH | 13.95 | - | |
99 | N-linked_Glycosylation | LQQEVLQNVSDAESC HHHHHHHCCCHHHHH | 30.97 | UniProtKB CARBOHYD | |
101 | Phosphorylation | QEVLQNVSDAESCYL HHHHHCCCHHHHHHH | 38.36 | - | |
111 | Phosphorylation | ESCYLVHTLLEFYLK HHHHHHHHHHHHHHH | 26.09 | - | |
122 | Ubiquitination | FYLKTVFKNYHNRTV HHHHHHHHHCCCCEE | 52.87 | 23078624 | |
126 | N-linked_Glycosylation | TVFKNYHNRTVEVRT HHHHHCCCCEEEEEE | 30.84 | UniProtKB CARBOHYD | |
133 | Phosphorylation | NRTVEVRTLKSFSTL CCEEEEEEHHHHHHH | 43.65 | - | |
161 | Phosphorylation | SQENEMFSIRDSAHR CCCCCCCCCCCHHHH | 18.53 | - | |
198 | Phosphorylation | GEVDILLTWMQKFYK HHHHHHHHHHHHHHC | 18.55 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IL24_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
122 | K | ubiquitylation |
| 23078624 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IL24_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CLUS_HUMAN | CLU | physical | 21732348 | |
RARG_HUMAN | RARG | physical | 21988832 | |
CHK2_HUMAN | CHEK2 | physical | 25640309 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...