UniProt ID | HXD1_HUMAN | |
---|---|---|
UniProt AC | Q9GZZ0 | |
Protein Name | Homeobox protein Hox-D1 | |
Gene Name | HOXD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 328 | |
Subcellular Localization | Nucleus. | |
Protein Description | Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures.. | |
Protein Sequence | MSSYLEYVSCSSSGGVGGDVLSLAPKFCRSDARPVALQPAFPLGNGDGAFVSCLPLAAARPSPSPPAAPARPSVPPPAAPQYAQCTLEGAYEPGAAPAAAAGGADYGFLGSGPAYDFPGVLGRAADDGGSHVHYATSAVFSGGGSFLLSGQVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEPS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
191 | Phosphorylation | APGTYPKSVSPASGL CCCCCCCCCCCCCCC | 24.27 | 24719451 | |
193 | Phosphorylation | GTYPKSVSPASGLPA CCCCCCCCCCCCCCC | 23.11 | 28857561 | |
223 | Phosphorylation | KKGKLAEYGAASPSS HCCCHHHHCCCCHHH | 13.37 | 24719451 | |
223 | Phosphorylation | KKGKLAEYGAASPSS HCCCHHHHCCCCHHH | 13.37 | 24719451 | |
227 | Phosphorylation | LAEYGAASPSSAIRT HHHHCCCCHHHHHHC | 25.44 | 26699800 | |
229 | Phosphorylation | EYGAASPSSAIRTNF HHCCCCHHHHHHCCC | 29.88 | 24719451 | |
229 | Phosphorylation | EYGAASPSSAIRTNF HHCCCCHHHHHHCCC | 29.88 | 26699800 | |
230 | Phosphorylation | YGAASPSSAIRTNFS HCCCCHHHHHHCCCC | 30.97 | 24719451 | |
230 | Phosphorylation | YGAASPSSAIRTNFS HCCCCHHHHHHCCCC | 30.97 | 24719451 | |
320 | Phosphorylation | KFIKNPGSPSQSQEP CCCCCCCCCCCCCCC | 23.72 | 24719451 | |
320 | Phosphorylation | KFIKNPGSPSQSQEP CCCCCCCCCCCCCCC | 23.72 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HXD1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HXD1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HXD1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of HXD1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...