HXD1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HXD1_HUMAN
• UniProt AC: Q9GZZ0
• Protein Name: Homeobox protein Hox-D1
• Gene Name: HOXD1
• Organism: Homo sapiens (Human).
• Sequence Length: 328
• Subcellular Localization: Nucleus.
• Protein Description: Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures..
• Protein Sequence: MSSYLEYVSCSSSGGVGGDVLSLAPKFCRSDARPVALQPAFPLGNGDGAFVSCLPLAAARPSPSPPAAPARPSVPPPAAPQYAQCTLEGAYEPGAAPAAAAGGADYGFLGSGPAYDFPGVLGRAADDGGSHVHYATSAVFSGGGSFLLSGQVDYAAFGEPGPFPACLKASADGHPGAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQLTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKREREGLLATAIPVAPLQLPLSGTTPTKFIKNPGSPSQSQEPS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
191	Phosphorylation	APGTYPKSVSPASGL CCCCCCCCCCCCCCC	24.27	24719451
193	Phosphorylation	GTYPKSVSPASGLPA CCCCCCCCCCCCCCC	23.11	28857561
223	Phosphorylation	KKGKLAEYGAASPSS HCCCHHHHCCCCHHH	13.37	24719451
223	Phosphorylation	KKGKLAEYGAASPSS HCCCHHHHCCCCHHH	13.37	24719451
227	Phosphorylation	LAEYGAASPSSAIRT HHHHCCCCHHHHHHC	25.44	26699800
229	Phosphorylation	EYGAASPSSAIRTNF HHCCCCHHHHHHCCC	29.88	24719451
229	Phosphorylation	EYGAASPSSAIRTNF HHCCCCHHHHHHCCC	29.88	26699800
230	Phosphorylation	YGAASPSSAIRTNFS HCCCCHHHHHHCCCC	30.97	24719451
230	Phosphorylation	YGAASPSSAIRTNFS HCCCCHHHHHHCCCC	30.97	24719451
320	Phosphorylation	KFIKNPGSPSQSQEP CCCCCCCCCCCCCCC	23.72	24719451
320	Phosphorylation	KFIKNPGSPSQSQEP CCCCCCCCCCCCCCC	23.72	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HXD1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HXD1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HXD1_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of HXD1_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.