OR4K1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OR4K1_HUMAN
• UniProt AC: Q8NGD4
• Protein Name: Olfactory receptor 4K1
• Gene Name: OR4K1
• Organism: Homo sapiens (Human).
• Sequence Length: 311
• Subcellular Localization: Cell membrane; Multi-pass membrane protein.
• Protein Description: Odorant receptor..
• Protein Sequence: MAHTNESMVSEFVLLGLSNSWGLQLFFFAIFSIVYVTSVLGNVLIIVIISFDSHLNSPMYFLLSNLSFIDICQSNFATPKMLVDFFIERKTISFEGCMAQIFVLHSFVGSEMMLLVAMAYDRFIAICKPLHYSTIMNRRLCVIFVSISWAVGVLHSVSHLAFTVDLPFCGPNEVDSFFCDLPLVIELACMDTYEMEIMTLTNSGLISLSCFLALIISYTIILIGVRCRSSSGSSKALSTLTAHITVVILFFGPCIYFYIWPFSRLPVDKFLSVFYTVCTPLLNPIIYSLRNEDVKAAMWKLRNRHVNSWKN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	N-linked_Glycosylation	---MAHTNESMVSEF ---CCCCCHHHHHHH	29.49	UniProtKB CARBOHYD
288	Phosphorylation	LLNPIIYSLRNEDVK HHCHHHHHCCCHHHH	15.50	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OR4K1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OR4K1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OR4K1_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of OR4K1_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.