UniProt ID | RIPL2_HUMAN | |
---|---|---|
UniProt AC | Q969X0 | |
Protein Name | RILP-like protein 2 | |
Gene Name | RILPL2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 211 | |
Subcellular Localization | Cytoplasm, cytosol . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cell projection, cilium. | |
Protein Description | Involved in cell shape and neuronal morphogenesis, positively regulating the establishment and maintenance of dendritic spines. Plays a role in cellular protein transport, including protein transport away from primary cilia. May function via activation of RAC1 and PAK1 (By similarity).. | |
Protein Sequence | MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVRVLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRDVLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKDAVVTSAKNAGRNKEEKTIIKKLFFFRSGKQT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
107 | Phosphorylation | VEGLRRQSPPASGEV HHHHHHCCCCCCCCC | 30.92 | 23401153 | |
111 | Phosphorylation | RRQSPPASGEVNLGP HHCCCCCCCCCCCCC | 41.06 | 28060719 | |
120 | Ubiquitination | EVNLGPNKMVVDLTD CCCCCCCCEEEECCC | 35.88 | 29967540 | |
149 | Ubiquitination | LQERNKLKSQLLVVQ HHHHHHHHHHHHHHH | 37.45 | - | |
187 | Ubiquitination | DAVVTSAKNAGRNKE CEEEECHHHCCCCHH | 47.28 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RIPL2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RIPL2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RIPL2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RIPL2_HUMAN | RILPL2 | physical | 16189514 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...