dbPTM

RIPL2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RIPL2_HUMAN
UniProt AC	Q969X0
Protein Name	RILP-like protein 2
Gene Name	RILPL2
Organism	Homo sapiens (Human).
Sequence Length	211
Subcellular Localization	Cytoplasm, cytosol . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cell projection, cilium.
Protein Description	Involved in cell shape and neuronal morphogenesis, positively regulating the establishment and maintenance of dendritic spines. Plays a role in cellular protein transport, including protein transport away from primary cilia. May function via activation of RAC1 and PAK1 (By similarity)..
Protein Sequence	MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPRVTQLQFKVVRVLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNKMVVDLTDPNRPRFTLQELRDVLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKDAVVTSAKNAGRNKEEKTIIKKLFFFRSGKQT

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
107	Phosphorylation	VEGLRRQSPPASGEV HHHHHHCCCCCCCCC	30.92	23401153
111	Phosphorylation	RRQSPPASGEVNLGP HHCCCCCCCCCCCCC	41.06	28060719
120	Ubiquitination	EVNLGPNKMVVDLTD CCCCCCCCEEEECCC	35.88	29967540
149	Ubiquitination	LQERNKLKSQLLVVQ HHHHHHHHHHHHHHH	37.45	-
187	Ubiquitination	DAVVTSAKNAGRNKE CEEEECHHHCCCCHH	47.28	29967540

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RIPL2_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RIPL2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RIPL2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
RIPL2_HUMAN	RILPL2	physical	16189514

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RIPL2_HUMAN

Related Literatures of Post-Translational Modification