UniProt ID | SEM1_HUMAN | |
---|---|---|
UniProt AC | P60896 | |
Protein Name | 26S proteasome complex subunit SEM1 | |
Gene Name | SEM1 {ECO:0000312|HGNC:HGNC:10845} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 70 | |
Subcellular Localization | ||
Protein Description | Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. [PubMed: 15117943 Component of the TREX-2 complex (transcription and export complex 2), composed of at least ENY2, GANP, PCID2, SEM1, and either centrin CETN2 or CETN3] | |
Protein Sequence | MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
62 | Ubiquitination | QLRAELEKHGYKMET HHHHHHHHCCCCCCC | - | ||
62 | Acetylation | QLRAELEKHGYKMET HHHHHHHHCCCCCCC | 27452117 | ||
65 | Phosphorylation | AELEKHGYKMETS-- HHHHHCCCCCCCC-- | - | ||
66 | Ubiquitination | ELEKHGYKMETS--- HHHHCCCCCCCC--- | 2190698 | ||
66 | Acetylation | ELEKHGYKMETS--- HHHHCCCCCCCC--- | 25953088 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SEM1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SEM1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SEM1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...