UniProt ID | RPF2_HUMAN | |
---|---|---|
UniProt AC | Q9H7B2 | |
Protein Name | Ribosome production factor 2 homolog | |
Gene Name | RPF2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 306 | |
Subcellular Localization | Nucleus, nucleolus . Associated with the nucleolus in an RNA-dependent manner. | |
Protein Description | Involved in ribosomal large subunit assembly. May regulate the localization of the 5S RNP/5S ribonucleoprotein particle to the nucleolus.. | |
Protein Sequence | MDTLDRVVKPKTKRAKRFLEKREPKLNENIKNAMLIKGGNANATVTKVLKDVYALKKPYGVLYKKKNITRPFEDQTSLEFFSKKSDCSLFMFGSHNKKRPNNLVIGRMYDYHVLDMIELGIENFVSLKDIKNSKCPEGTKPMLIFAGDDFDVTEDYRRLKSLLIDFFRGPTVSNIRLAGLEYVLHFTALNGKIYFRSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKKRPAERITEDHEKKSKRIKKN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDTLDRVV -------CCHHHHHC | 8.84 | - | |
6 | Methylation | --MDTLDRVVKPKTK --CCHHHHHCCCCCH | 37.94 | - | |
13 | Ubiquitination | RVVKPKTKRAKRFLE HHCCCCCHHHHHHHH | 57.39 | 24816145 | |
20 | Ubiquitination | KRAKRFLEKREPKLN HHHHHHHHHCCCHHC | 47.56 | 29967540 | |
31 | Ubiquitination | PKLNENIKNAMLIKG CHHCHHHCHHEEEEC | 50.68 | 29967540 | |
37 | Ubiquitination | IKNAMLIKGGNANAT HCHHEEEECCCCCCC | 57.72 | 29967540 | |
47 | Acetylation | NANATVTKVLKDVYA CCCCCHHHHHHHHHH | 41.03 | 91019 | |
50 | 2-Hydroxyisobutyrylation | ATVTKVLKDVYALKK CCHHHHHHHHHHHHC | 48.40 | - | |
50 | Malonylation | ATVTKVLKDVYALKK CCHHHHHHHHHHHHC | 48.40 | 32601280 | |
50 | Acetylation | ATVTKVLKDVYALKK CCHHHHHHHHHHHHC | 48.40 | 26051181 | |
56 | Acetylation | LKDVYALKKPYGVLY HHHHHHHHCCCEEEE | 43.46 | 91023 | |
57 | Malonylation | KDVYALKKPYGVLYK HHHHHHHCCCEEEEE | 44.30 | 26320211 | |
57 | Acetylation | KDVYALKKPYGVLYK HHHHHHHCCCEEEEE | 44.30 | 26051181 | |
59 | Phosphorylation | VYALKKPYGVLYKKK HHHHHCCCEEEEECC | 28.84 | - | |
83 | 2-Hydroxyisobutyrylation | TSLEFFSKKSDCSLF CCHHHHHCCCCCEEE | 51.65 | - | |
83 | Acetylation | TSLEFFSKKSDCSLF CCHHHHHCCCCCEEE | 51.65 | 26051181 | |
83 | Ubiquitination | TSLEFFSKKSDCSLF CCHHHHHCCCCCEEE | 51.65 | 29967540 | |
84 | Acetylation | SLEFFSKKSDCSLFM CHHHHHCCCCCEEEE | 50.78 | 26051181 | |
97 | Acetylation | FMFGSHNKKRPNNLV EEECCCCCCCCCCEE | 44.74 | 26051181 | |
98 | Ubiquitination | MFGSHNKKRPNNLVI EECCCCCCCCCCEEE | 77.67 | - | |
109 | Phosphorylation | NLVIGRMYDYHVLDM CEEEEECCCHHHHHH | 16.40 | - | |
140 | Acetylation | SKCPEGTKPMLIFAG CCCCCCCCCEEEEEC | 39.01 | 26051181 | |
156 | Phosphorylation | DFDVTEDYRRLKSLL CCCCCHHHHHHHHHH | 7.44 | - | |
160 | Ubiquitination | TEDYRRLKSLLIDFF CHHHHHHHHHHHHHH | 36.93 | - | |
189 | Ubiquitination | YVLHFTALNGKIYFR EEEEEEEECCEEEEE | 8.68 | 29967540 | |
194 | Phosphorylation | TALNGKIYFRSYKLL EEECCEEEEEEEEHH | 9.09 | 20393185 | |
209 | Ubiquitination | LKKSGCRTPRIELEE HHHCCCCCCCEEHHH | 22.46 | 24816145 | |
212 | Ubiquitination | SGCRTPRIELEEMGP CCCCCCCEEHHHHCC | 8.14 | 29967540 | |
220 | Phosphorylation | ELEEMGPSLDLVLRR EHHHHCCCHHHHHHH | 28.87 | 20860994 | |
236 | Phosphorylation | HLASDDLYKLSMKMP CCCCHHHHHHHHCCC | 19.51 | - | |
236 | Ubiquitination | HLASDDLYKLSMKMP CCCCHHHHHHHHCCC | 19.51 | 24816145 | |
239 | Phosphorylation | SDDLYKLSMKMPKAL CHHHHHHHHCCCHHC | 16.53 | 23090842 | |
241 | Ubiquitination | DLYKLSMKMPKALKP HHHHHHHCCCHHCCC | 48.99 | - | |
252 | Malonylation | ALKPKKKKNISHDTF HCCCCCCCCCCCCCC | 69.28 | 26320211 | |
252 | Acetylation | ALKPKKKKNISHDTF HCCCCCCCCCCCCCC | 69.28 | 27452117 | |
252 | Ubiquitination | ALKPKKKKNISHDTF HCCCCCCCCCCCCCC | 69.28 | 29967540 | |
255 | Phosphorylation | PKKKKNISHDTFGTT CCCCCCCCCCCCHHH | 25.38 | 25159151 | |
258 | Phosphorylation | KKNISHDTFGTTYGR CCCCCCCCCHHHHHH | 20.67 | 29978859 | |
261 | Phosphorylation | ISHDTFGTTYGRIHM CCCCCCHHHHHHHHH | 16.80 | 28442448 | |
262 | Phosphorylation | SHDTFGTTYGRIHMQ CCCCCHHHHHHHHHC | 25.10 | 28442448 | |
263 | Phosphorylation | HDTFGTTYGRIHMQK CCCCHHHHHHHHHCH | 12.30 | 28152594 | |
270 | Ubiquitination | YGRIHMQKQDLSKLQ HHHHHHCHHHHHHHH | 37.90 | - | |
275 | 2-Hydroxyisobutyrylation | MQKQDLSKLQTRKMK HCHHHHHHHHHHHHC | 52.49 | - | |
275 | Ubiquitination | MQKQDLSKLQTRKMK HCHHHHHHHHHHHHC | 52.49 | 29967540 | |
278 | Phosphorylation | QDLSKLQTRKMKGLK HHHHHHHHHHHCCCC | 42.57 | 20860994 | |
299 | Ubiquitination | ITEDHEKKSKRIKKN CCCHHHHHHHHHCCC | 59.22 | 24816145 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RPF2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RPF2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RPF2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
PUM3_HUMAN | KIAA0020 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. |