UniProt ID | FXL20_HUMAN | |
---|---|---|
UniProt AC | Q96IG2 | |
Protein Name | F-box/LRR-repeat protein 20 | |
Gene Name | FBXL20 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 436 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Role in neural transmission (By similarity).. | |
Protein Sequence | MRRDVNGVTKSRFEMFSNSDEAVINKKLPKELLLRIFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDLFDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLEHLKSCHSLERIELYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPPSVGGSRQRFCRCCIIL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | RRDVNGVTKSRFEMF CCCCCCCCHHHHHHC | 25.38 | 30622161 | |
10 | Ubiquitination | RDVNGVTKSRFEMFS CCCCCCCHHHHHHCC | 36.91 | 29967540 | |
87 | Ubiquitination | RVVENISKRCGGFLR CHHHHHHHHCCHHHH | 48.16 | - | |
97 | Phosphorylation | GGFLRKLSLRGCLGV CHHHHHCHHCCCCCC | 21.03 | 17322306 | |
129 | Ubiquitination | LNLNGCTKTTDATCT EECCCCCCCCCCCHH | 54.20 | 32015554 | |
130 | Phosphorylation | NLNGCTKTTDATCTS ECCCCCCCCCCCHHH | 16.26 | 26552605 | |
131 | Phosphorylation | LNGCTKTTDATCTSL CCCCCCCCCCCHHHH | 25.78 | 26552605 | |
134 | Phosphorylation | CTKTTDATCTSLSKF CCCCCCCCHHHHHHH | 21.08 | 26552605 | |
136 | Phosphorylation | KTTDATCTSLSKFCS CCCCCCHHHHHHHHH | 28.48 | 26552605 | |
137 | Phosphorylation | TTDATCTSLSKFCSK CCCCCHHHHHHHHHH | 32.56 | 26552605 | |
139 | Phosphorylation | DATCTSLSKFCSKLR CCCHHHHHHHHHHCC | 24.37 | 26552605 | |
140 | Ubiquitination | ATCTSLSKFCSKLRH CCHHHHHHHHHHCCC | 56.54 | 29967540 | |
166 | Ubiquitination | MSLKALSEGCPLLEQ HHHHHHHCCCCHHHH | 66.71 | 23000965 | |
171 | Ubiquitination | LSEGCPLLEQLNISW HHCCCCHHHHCCCCC | 2.08 | 23000965 | |
198 | Ubiquitination | VRGCGGLKALFLKGC HHHCCHHHHHHHCCC | 46.44 | 23000965 | |
203 | Ubiquitination | GLKALFLKGCTQLED HHHHHHHCCCCCCHH | 44.60 | 23000965 | |
208 | Ubiquitination | FLKGCTQLEDEALKY HHCCCCCCHHHHHHH | 4.89 | 23000965 | |
235 | Ubiquitination | LQTCLQITDEGLITI HHHHCCCCCCHHHHH | 18.29 | 23000965 | |
240 | Ubiquitination | QITDEGLITICRGCH CCCCCHHHHHCHHHH | 3.43 | 23000965 | |
287 | Phosphorylation | VARCSQLTDVGFTTL HHCHHHCCCCCHHHH | 22.47 | 22210691 | |
385 | Phosphorylation | CHSLERIELYDCQQI CCCCCEEEEECHHHH | 47.72 | 32645325 | |
389 | Phosphorylation | ERIELYDCQQITRAG CEEEEECHHHHHHHH | 1.71 | 32142685 | |
412 | Phosphorylation | PNIKVHAYFAPVTPP CCCEEEEEECCCCCC | 5.84 | 30266825 | |
417 | Phosphorylation | HAYFAPVTPPPSVGG EEEECCCCCCCCCCC | 29.08 | 29255136 | |
421 | Phosphorylation | APVTPPPSVGGSRQR CCCCCCCCCCCCCCC | 38.89 | 23927012 | |
422 | Phosphorylation | PVTPPPSVGGSRQRF CCCCCCCCCCCCCCE | 14.36 | 32645325 | |
425 | Phosphorylation | PPPSVGGSRQRFCRC CCCCCCCCCCCEEEE | 21.22 | 30266825 | |
426 | Phosphorylation | PPSVGGSRQRFCRCC CCCCCCCCCCEEEEE | 34.66 | 32142685 | |
454 | Phosphorylation | ------------------------- ------------------------- | 32645325 | ||
458 | Phosphorylation | ----------------------------- ----------------------------- | 32142685 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FXL20_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FXL20_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FXL20_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FXL20_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-417, AND MASSSPECTROMETRY. | |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-417, AND MASSSPECTROMETRY. | |
"Phosphoproteome of resting human platelets."; Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J.,Schuetz C., Walter U., Gambaryan S., Sickmann A.; J. Proteome Res. 7:526-534(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-417, AND MASSSPECTROMETRY. |