| UniProt ID | SYPL2_HUMAN | |
|---|---|---|
| UniProt AC | Q5VXT5 | |
| Protein Name | Synaptophysin-like protein 2 | |
| Gene Name | SYPL2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 272 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein. Triad junction, the junctional complex between the transverse tubule and the sarcoplasmic reticulum.. |
|
| Protein Description | Involved in communication between the T-tubular and junctional sarcoplasmic reticulum (SR) membranes.. | |
| Protein Sequence | MSSTESAGRTADKSPRQQVDRLLVGLRWRRLEEPLGFIKVLQWLFAIFAFGSCGSYSGETGAMVRCNNEAKDVSSIIVAFGYPFRLHRIQYEMPLCDEESSSKTMHLMGDFSAPAEFFVTLGIFSFFYTMAALVIYLRFHNLYTENKRFPLVDFCVTVSFTFFWLVAAAAWGKGLTDVKGATRPSSLTAAMSVCHGEEAVCSAGATPSMGLANISVLFGFINFFLWAGNCWFVFKETPWHGQGQGQDQDQDQDQGQGPSQESAAEQGAVEKQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 213 | N-linked_Glycosylation | TPSMGLANISVLFGF CCCCCHHHHHHHHHH | 31.91 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SYPL2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SYPL2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SYPL2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TM192_HUMAN | TMEM192 | physical | 28514442 | |
| T120A_HUMAN | TMEM120A | physical | 28514442 | |
| MFS12_HUMAN | MFSD12 | physical | 28514442 | |
| REEP6_HUMAN | REEP6 | physical | 28514442 | |
| NECT2_HUMAN | PVRL2 | physical | 28514442 | |
| GRP78_HUMAN | HSPA5 | physical | 28514442 | |
| GRAN_HUMAN | GCA | physical | 28514442 | |
| TSN15_HUMAN | TSPAN15 | physical | 28514442 | |
| RTN2_HUMAN | RTN2 | physical | 28514442 | |
| VAMP3_HUMAN | VAMP3 | physical | 28514442 | |
| SNG2_HUMAN | SYNGR2 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
