TGIF2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TGIF2_HUMAN
• UniProt AC: Q9GZN2
• Protein Name: Homeobox protein TGIF2
• Gene Name: TGIF2
• Organism: Homo sapiens (Human).
• Sequence Length: 237
• Subcellular Localization: Nucleus. Excluded from nucleoli.
• Protein Description: Transcriptional repressor, which probably repress transcription by binding directly the 5'-CTGTCAA-3' DNA sequence or by interacting with TGF-beta activated SMAD proteins. Probably represses transcription via the recruitment of histone deacetylase proteins..
• Protein Sequence: MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSDSDLGED ------CCHHHCCCC	45.91	25159151
4	Phosphorylation	----MSDSDLGEDEG ----CCHHHCCCCCC	27.68	25159151
14	Phosphorylation	GEDEGLLSLAGKRKR CCCCCHHHHHHHHHC	22.63	26074081
86	Ubiquitination	DMLRKDGKDPNQFTI HHHHHCCCCCCCEEE	78.95	-
92	Phosphorylation	GKDPNQFTISRRGGK CCCCCCEEEECCCCC	14.31	28555341
101	Phosphorylation	SRRGGKASDVALPRG ECCCCCHHHCCCCCC	35.78	28555341
109	Phosphorylation	DVALPRGSSPSVLAV HCCCCCCCCCCEEEE	40.11	25159151
110	Phosphorylation	VALPRGSSPSVLAVS CCCCCCCCCCEEEEE	24.82	25159151
112	Phosphorylation	LPRGSSPSVLAVSVP CCCCCCCCEEEEEEC	31.54	25159151
153	Phosphorylation	FPRGELESPKPLVTP CCCCCCCCCCCCCCC	51.34	25159151
159	Phosphorylation	ESPKPLVTPGSTLTL CCCCCCCCCCCEEEE	29.61	26055452
162	Phosphorylation	KPLVTPGSTLTLLTR CCCCCCCCEEEEEEE	22.80	20068231
163	Phosphorylation	PLVTPGSTLTLLTRA CCCCCCCEEEEEEEC	29.67	20068231
165	Phosphorylation	VTPGSTLTLLTRAEA CCCCCEEEEEEECCC	21.58	20068231
168	Phosphorylation	GSTLTLLTRAEAGSP CCEEEEEEECCCCCC	30.83	20068231
174	Phosphorylation	LTRAEAGSPTGGLFN EEECCCCCCCCCCCC	26.74	25159151
176	Phosphorylation	RAEAGSPTGGLFNTP ECCCCCCCCCCCCCC	45.65	27362937
182	Phosphorylation	PTGGLFNTPPPTPPE CCCCCCCCCCCCCCC	29.82	22777824
186	Phosphorylation	LFNTPPPTPPEQDKE CCCCCCCCCCCCCCC	58.19	22777824
227	Phosphorylation	PSLPLLHTPIPLVSE CCCCCCCCCCCCCCC	23.92	26074081

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TGIF2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TGIF2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TGIF2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SMAD3_HUMAN	SMAD3	physical	11427533

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.