UniProt ID | HIG2A_HUMAN | |
---|---|---|
UniProt AC | Q9BW72 | |
Protein Name | HIG1 domain family member 2A, mitochondrial | |
Gene Name | HIGD2A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 106 | |
Subcellular Localization |
Mitochondrion membrane Multi-pass membrane protein . Mitochondrion inner membrane . |
|
Protein Description | Proposed subunit of cytochrome c oxidase (COX, complex IV), which is the terminal component of the mitochondrial respiratory chain that catalyzes the reduction of oxygen to water. May be involved in cytochrome c oxidase activity. May play a role in the assembly of respiratory supercomplexes.. | |
Protein Sequence | MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRGNSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MATPGPVIP ------CCCCCCCCC | 23.62 | 25944712 | |
3 | Phosphorylation | -----MATPGPVIPE -----CCCCCCCCCC | 27.72 | 18491316 | |
74 | Dimethylation | FHRGNSQRSQLMMRT CCCCCCHHHHHHHHH | 26.62 | - | |
74 | Methylation | FHRGNSQRSQLMMRT CCCCCCHHHHHHHHH | 26.62 | 24412339 | |
89 | Phosphorylation | RIAAQGFTVAAILLG HHHHCCHHHHHHHHH | 18.96 | 22210691 | |
100 | Phosphorylation | ILLGLAVTAMKSRP- HHHHHHHHHHHCCC- | 18.54 | 24719451 | |
102 | Sulfoxidation | LGLAVTAMKSRP--- HHHHHHHHHCCC--- | 2.71 | 28183972 | |
104 | Phosphorylation | LAVTAMKSRP----- HHHHHHHCCC----- | 36.38 | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HIG2A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HIG2A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HIG2A_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |