UniProt ID | ARL4A_HUMAN | |
---|---|---|
UniProt AC | P40617 | |
Protein Name | ADP-ribosylation factor-like protein 4A | |
Gene Name | ARL4A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 200 | |
Subcellular Localization | Cell membrane. Cytoplasm. Nucleus, nucleolus. Localization in the nucleolus is dependent by nucleotide binding. | |
Protein Description | Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in GDP-bound form.. | |
Protein Sequence | MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGNGLSDQT ------CCCCCCCHH | 36.59 | - | |
58 | Ubiquitination | TKGFNTEKIKVTLGN CCCCCCCEEEEEECC | 45.87 | - | |
113 | Phosphorylation | ERMEEAKTELHKITR HHHHHHHHHHHHHHH | 51.32 | - | |
117 | Ubiquitination | EAKTELHKITRISEN HHHHHHHHHHHCCCC | 59.40 | - | |
135 | Ubiquitination | PVLIVANKQDLRNSL CEEEEECHHHHHHCC | 35.14 | 21906983 | |
141 | Phosphorylation | NKQDLRNSLSLSEIE CHHHHHHCCCHHHHH | 16.95 | 29978859 | |
143 | Phosphorylation | QDLRNSLSLSEIEKL HHHHHCCCHHHHHHH | 29.66 | 29978859 | |
145 | Phosphorylation | LRNSLSLSEIEKLLA HHHCCCHHHHHHHHH | 32.90 | 30622161 | |
181 | Acetylation | GLKEGLEKLHDMIIK HHHHHHHHHHHHHHH | 57.05 | 18604399 | |
188 | Ubiquitination | KLHDMIIKRRKMLRQ HHHHHHHHHHHHHHH | 34.91 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL4A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL4A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL4A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IMA1_HUMAN | KPNA2 | physical | 10980193 | |
C102B_HUMAN | CCDC102B | physical | 25416956 | |
SPC1L_HUMAN | SPATC1L | physical | 25416956 | |
CCD57_HUMAN | CCDC57 | physical | 25416956 | |
ELMO1_HUMAN | ELMO1 | physical | 21930703 | |
RAC1_HUMAN | RAC1 | physical | 21930703 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...