UniProt ID | OR2H2_HUMAN | |
---|---|---|
UniProt AC | O95918 | |
Protein Name | Olfactory receptor 2H2 | |
Gene Name | OR2H2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 312 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
Protein Description | Odorant receptor.. | |
Protein Sequence | MVNQSSTPGFLLLGFSEHPGLERTLFVVVLTSYLLTLVGNTLIILLSALDPKLHSPMYFFLSNLSFLDLCFTTSCVPQMLVNLWGPKKTISFLDCSVQIFIFLSLGTTECILLTVMAFDRYVAVCQPLHYATIIHPRLCWQLASVAWVIGLVESVVQTPSTLHLPFCPDRQVDDFVCEVPALIRLSCEDTSYNEIQVAVASVFILVVPLSLILVSYGAITWAVLRINSAKGRRKAFGTCSSHLTVVTLFYSSVIAVYLQPKNPYAQERGKFFGLFYAVGTPSLNPLIYTLRNKEVTRAFRRLLGKEMGLTQS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | N-linked_Glycosylation | -----MVNQSSTPGF -----CCCCCCCCCE | 34.42 | UniProtKB CARBOHYD | |
5 | Phosphorylation | ---MVNQSSTPGFLL ---CCCCCCCCCEEE | 30.86 | 24043423 | |
6 | Phosphorylation | --MVNQSSTPGFLLL --CCCCCCCCCEEEE | 28.93 | 24043423 | |
7 | Phosphorylation | -MVNQSSTPGFLLLG -CCCCCCCCCEEEEE | 32.45 | 24043423 | |
16 | Phosphorylation | GFLLLGFSEHPGLER CEEEEECCCCCCCHH | 32.95 | 24043423 | |
31 | Phosphorylation | TLFVVVLTSYLLTLV HHHHHHHHHHHHHHH | 12.06 | - | |
238 | Phosphorylation | GRRKAFGTCSSHLTV CCHHHCCCCCCCHHH | 11.62 | 22468782 | |
250 | Phosphorylation | LTVVTLFYSSVIAVY HHHHHHHHHCHHHHH | 11.80 | 22468782 | |
251 | Phosphorylation | TVVTLFYSSVIAVYL HHHHHHHHCHHHHHH | 15.70 | 22468782 | |
289 | Phosphorylation | SLNPLIYTLRNKEVT CCCCHHHHHCCHHHH | 16.55 | 24719451 | |
312 | Phosphorylation | KEMGLTQS------- HHHCCCCC------- | 36.63 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OR2H2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OR2H2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OR2H2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of OR2H2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...