UniProt ID | EBLN2_HUMAN | |
---|---|---|
UniProt AC | Q6P2I7 | |
Protein Name | Endogenous Bornavirus-like nucleoprotein 2 | |
Gene Name | EBLN2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 272 | |
Subcellular Localization | ||
Protein Description | May act as an RNA-binding protein. The C-terminal region is highly homologous to the bornavirus nucleocapsid N protein that binds viral RNA and oligomerizes. The viral protein also possesses a nuclear import and a nuclear export signal. These 2 signals seem absent in EBLN-2 supporting an unrelated function in Human.. | |
Protein Sequence | MGYFLKLYAYVNSHSLFVWVCDRSYKRSFRPMILNKIKELSRNQFSTMSHLRKDSQPSSPGDDAMDRSGLPDLQGRFELSGKNRQYPLDALEPQPSIGDIKDIKKAAKSMLDPAHKSHFHPVTPSLVFLCFIFDGLHQALLSVGVSKRSNTVVGNENEERGTPYASRFKDMPNFIALEKSSVLRHCCDLLIGIAAGSSDKICTSSLQVQRRFKAMMASIGRLSHGESADLLISCNAESAIGWISSRPWVGELMFTLLFGDFESPLHKLRKSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | YFLKLYAYVNSHSLF HHHHHHEEECCCCEE | 6.14 | 24719451 | |
13 | Phosphorylation | KLYAYVNSHSLFVWV HHHEEECCCCEEEEE | 12.38 | 24719451 | |
28 | Phosphorylation | CDRSYKRSFRPMILN ECCCCCHHCHHHHHH | 22.81 | - | |
86 | Phosphorylation | LSGKNRQYPLDALEP CCCCCCCCCCHHCCC | 11.52 | - | |
218 | Phosphorylation | RFKAMMASIGRLSHG HHHHHHHHHHCCCCC | 14.00 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EBLN2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EBLN2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EBLN2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of EBLN2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...