UniProt ID | CCL5_HUMAN | |
---|---|---|
UniProt AC | P13501 | |
Protein Name | C-C motif chemokine 5 | |
Gene Name | CCL5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 91 | |
Subcellular Localization | Secreted. | |
Protein Description | Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. May activate several chemokine receptors including CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. [PubMed: 16791620] | |
Protein Sequence | MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | LAVILIATALCAPAS HHHHHHHHHHHCCCC | 17.11 | 25332170 | |
26 | Phosphorylation | APASASPYSSDTTPC CCCCCCCCCCCCCCC | 20.50 | 25332170 | |
27 | O-linked_Glycosylation | PASASPYSSDTTPCC CCCCCCCCCCCCCCC | 25.73 | 1380064 | |
27 | O-linked_Glycosylation | PASASPYSSDTTPCC CCCCCCCCCCCCCCC | 25.73 | 1380064 | |
27 | Phosphorylation | PASASPYSSDTTPCC CCCCCCCCCCCCCCC | 25.73 | 25332170 | |
28 | O-linked_Glycosylation | ASASPYSSDTTPCCF CCCCCCCCCCCCCCH | 32.88 | 1380064 | |
28 | O-linked_Glycosylation | ASASPYSSDTTPCCF CCCCCCCCCCCCCCH | 32.88 | 1380064 | |
68 | Ubiquitination | AVVFVTRKNRQVCAN EEEEEEECCCCEECC | 47.30 | - | |
90 | Methionine sulfoxide | EYINSLEMS------ HHHHHHCCC------ | 7.55 | - | |
90 | Oxidation | EYINSLEMS------ HHHHHHCCC------ | 7.55 | 1380064 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CCL5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCL5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCL5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SDC1_HUMAN | SDC1 | physical | 14637022 | |
SDC4_HUMAN | SDC4 | physical | 14637022 | |
CCR5_HUMAN | CCR5 | physical | 14637022 | |
IL8_HUMAN | CXCL8 | physical | 11509627 | |
CCL2_HUMAN | CCL2 | genetic | 11350939 | |
CCR1_HUMAN | CCR1 | physical | 11449371 | |
CCR3_HUMAN | CCR3 | physical | 11449371 | |
CCR5_HUMAN | CCR5 | physical | 11449371 | |
CCR1_HUMAN | CCR1 | physical | 11116158 | |
CCR5_HUMAN | CCR5 | physical | 11116158 | |
TRIP6_HUMAN | TRIP6 | physical | 21988832 | |
GTR5_HUMAN | SLC2A5 | physical | 21988832 | |
RAGP1_HUMAN | RANGAP1 | physical | 21988832 | |
TF65_HUMAN | RELA | physical | 21988832 | |
EDC4_HUMAN | EDC4 | physical | 21988832 | |
CO4A_HUMAN | C4A | physical | 28514442 | |
NTM1A_HUMAN | NTMT1 | physical | 28514442 | |
SPT20_HUMAN | SPATA20 | physical | 28514442 | |
KAD4_HUMAN | AK4 | physical | 28514442 | |
UBAC1_HUMAN | UBAC1 | physical | 28514442 | |
SPRY4_HUMAN | SPRYD4 | physical | 28514442 | |
GPD1L_HUMAN | GPD1L | physical | 28514442 | |
S10AD_HUMAN | S100A13 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
O-linked Glycosylation | |
Reference | PubMed |
"Cytokine RANTES released by thrombin-stimulated platelets is a potentattractant for human eosinophils."; Kameyoshi Y., Doerschner A., Mallet A.I., Christophers E.,Schroeder J.-M.; J. Exp. Med. 176:587-592(1992). Cited for: PROTEIN SEQUENCE OF 24-55, FUNCTION, MASS SPECTROMETRY, GLYCOSYLATIONAT SER-27 AND SER-28, AND OXIDATION AT MET-90. |