UniProt ID | S10AD_HUMAN | |
---|---|---|
UniProt AC | Q99584 | |
Protein Name | Protein S100-A13 | |
Gene Name | S100A13 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 98 | |
Subcellular Localization | Cytoplasm. Secreted. Secretion is mediated by exposure to stress and requires copper ions. | |
Protein Description | Plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. Binds two calcium ions per subunit. Binds one copper ion. Binding of one copper ion does not interfere with calcium binding. Required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine (By similarity).. | |
Protein Sequence | MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
30 | Ubiquitination | FARQEGRKDSLSVNE HHHHCCCCCCCCHHH | 63.63 | 33845483 | |
32 | Phosphorylation | RQEGRKDSLSVNEFK HHCCCCCCCCHHHHH | 26.11 | 29255136 | |
34 | Phosphorylation | EGRKDSLSVNEFKEL CCCCCCCCHHHHHHH | 27.18 | 29255136 | |
51 | Ubiquitination | QQLPHLLKDVGSLDE HHHHHHHHHHCCCCH | 57.64 | 29967540 | |
51 | Acetylation | QQLPHLLKDVGSLDE HHHHHHHHHHCCCCH | 57.64 | 26051181 | |
55 | Phosphorylation | HLLKDVGSLDEKMKS HHHHHHCCCCHHHHC | 32.28 | 21712546 | |
59 | Ubiquitination | DVGSLDEKMKSLDVN HHCCCCHHHHCCCCC | 51.82 | 23000965 | |
59 | Acetylation | DVGSLDEKMKSLDVN HHCCCCHHHHCCCCC | 51.82 | 27452117 | |
61 | Ubiquitination | GSLDEKMKSLDVNQD CCCCHHHHCCCCCCC | 59.96 | 23000965 | |
62 | Phosphorylation | SLDEKMKSLDVNQDS CCCHHHHCCCCCCCC | 26.72 | 25159151 | |
69 | Phosphorylation | SLDVNQDSELKFNEY CCCCCCCCHHHHHHH | 34.76 | 21712546 | |
85 | Acetylation | RLIGELAKEIRKKKD HHHHHHHHHHHHHHC | 67.32 | 26051181 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S10AD_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S10AD_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S10AD_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SYT1_HUMAN | SYT1 | physical | 9712836 | |
FGF1_HUMAN | FGF1 | physical | 9712836 | |
FGF1_HUMAN | FGF1 | physical | 11432880 | |
SYT1_HUMAN | SYT1 | physical | 11432880 | |
STK4_HUMAN | STK4 | physical | 22939629 | |
THOC7_HUMAN | THOC7 | physical | 22939629 | |
S10AD_HUMAN | S100A13 | physical | 25416956 | |
PKHF2_HUMAN | PLEKHF2 | physical | 25416956 |
loading...