UniProt ID | MOB3A_HUMAN | |
---|---|---|
UniProt AC | Q96BX8 | |
Protein Name | MOB kinase activator 3A | |
Gene Name | MOB3A | |
Organism | Homo sapiens (Human). | |
Sequence Length | 217 | |
Subcellular Localization | ||
Protein Description | May regulate the activity of kinases.. | |
Protein Sequence | MSNPFLKQVFNKDKTFRPKRKFEPGTQRFELHKKAQASLNAGLDLRLAVQLPPGEDLNDWVAVHVVDFFNRVNLIYGTISDGCTEQSCPVMSGGPKYEYRWQDEHKFRKPTALSAPRYMDLLMDWIEAQINNEDLFPTNVGTPFPKNFLQTVRKILSRLFRVFVHVYIHHFDRIAQMGSEAHVNTCYKHFYYFVKEFGLIDTKELEPLKEMTARMCH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSNPFLKQV ------CCCHHHHHH | 53.89 | 24719451 | |
7 | Ubiquitination | -MSNPFLKQVFNKDK -CCCHHHHHHHCCCC | 44.81 | - | |
15 | Phosphorylation | QVFNKDKTFRPKRKF HHHCCCCCCCCCCCC | 34.70 | - | |
21 | Ubiquitination | KTFRPKRKFEPGTQR CCCCCCCCCCCCCCC | 61.27 | 29967540 | |
26 | Phosphorylation | KRKFEPGTQRFELHK CCCCCCCCCCHHHHH | 27.56 | 28060719 | |
38 | Phosphorylation | LHKKAQASLNAGLDL HHHHHHHHHHCCCCE | 15.29 | 28450419 | |
96 | Sumoylation | PVMSGGPKYEYRWQD CCCCCCCCCEEEECC | 54.73 | - | |
106 | Ubiquitination | YRWQDEHKFRKPTAL EEECCCCCCCCCCCC | 44.83 | - | |
109 | Ubiquitination | QDEHKFRKPTALSAP CCCCCCCCCCCCCCH | 50.26 | - | |
111 | Phosphorylation | EHKFRKPTALSAPRY CCCCCCCCCCCCHHH | 43.18 | 22673903 | |
114 | Phosphorylation | FRKPTALSAPRYMDL CCCCCCCCCHHHHHH | 33.49 | 23312004 | |
203 | Ubiquitination | EFGLIDTKELEPLKE HHCCCCHHCCHHHHH | 57.46 | 29967540 | |
209 | Ubiquitination | TKELEPLKEMTARMC HHCCHHHHHHHHHHC | 57.04 | 29967540 | |
212 | Phosphorylation | LEPLKEMTARMCH-- CHHHHHHHHHHCC-- | 16.53 | 28857561 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MOB3A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MOB3A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MOB3A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LATS1_HUMAN | LATS1 | physical | 19739119 | |
LATS2_HUMAN | LATS2 | physical | 19739119 | |
A4_HUMAN | APP | physical | 21832049 | |
TGIF1_HUMAN | TGIF1 | physical | 21516116 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...