| UniProt ID | LCE5A_HUMAN | |
|---|---|---|
| UniProt AC | Q5TCM9 | |
| Protein Name | Late cornified envelope protein 5A | |
| Gene Name | LCE5A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 118 | |
| Subcellular Localization | ||
| Protein Description | Precursors of the cornified envelope of the stratum corneum.. | |
| Protein Sequence | MSCQQSQQQCQPPPKCTPKCPPKCTPKCPPKCPPKCPPQCSAPCPPPVSSCCGSSSGGCCSSEGGGCCLSHHRPRQSLRRRPQSSSCCGSGSGQQSGGSSCCHSSGGSGCCHSSGGCC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Phosphorylation | CQPPPKCTPKCPPKC CCCCCCCCCCCCCCC | 31.73 | - | |
| 41 | Phosphorylation | PKCPPQCSAPCPPPV CCCCCCCCCCCCCCC | 29.96 | 28787133 | |
| 49 | Phosphorylation | APCPPPVSSCCGSSS CCCCCCCHHHCCCCC | 24.35 | 28787133 | |
| 104 | Phosphorylation | GGSSCCHSSGGSGCC CCCCCCCCCCCCCCC | 19.43 | 30576142 | |
| 113 | Phosphorylation | GGSGCCHSSGGCC-- CCCCCCCCCCCCC-- | 19.43 | 30576142 | |
| 114 | Phosphorylation | GSGCCHSSGGCC--- CCCCCCCCCCCC--- | 18.62 | 30576142 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LCE5A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LCE5A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LCE5A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of LCE5A_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...