THRSP_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: THRSP_HUMAN
• UniProt AC: Q92748
• Protein Name: Thyroid hormone-inducible hepatic protein
• Gene Name: THRSP
• Organism: Homo sapiens (Human).
• Sequence Length: 146
• Subcellular Localization: Nucleus . Cytoplasm .
• Protein Description: Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA (By similarity). May function as transcriptional coactivator. May modulate the transcription factor activity of THRB..
• Protein Sequence: MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MQVLTKRYPKNC ---CCCCCCCCCCCC	18.02	28102081
8	Phosphorylation	MQVLTKRYPKNCLLT CCCCCCCCCCCCCHH	21.80	28102081

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of THRSP_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of THRSP_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of THRSP_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
THRSP_HUMAN	THRSP	physical	25416956

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.