WFD12_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: WFD12_HUMAN
• UniProt AC: Q8WWY7
• Protein Name: WAP four-disulfide core domain protein 12
• Gene Name: WFDC12
• Organism: Homo sapiens (Human).
• Sequence Length: 111
• Subcellular Localization: Secreted .
• Protein Description: Antibacterial protein. Putative acid-stable proteinase inhibitor..
• Protein Sequence: MGSSSFLVLMVSLVLVTLVAVEGVKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MGSSSFLVLM -----CCCHHHHHHH	22.85	22496350
5	Phosphorylation	---MGSSSFLVLMVS ---CCCHHHHHHHHH	25.05	22496350
12	Phosphorylation	SFLVLMVSLVLVTLV HHHHHHHHHHHHHHH	9.97	22496350
17	Phosphorylation	MVSLVLVTLVAVEGV HHHHHHHHHHHHHHH	16.02	22496350

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of WFD12_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of WFD12_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of WFD12_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of WFD12_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.