| UniProt ID | WFD12_HUMAN | |
|---|---|---|
| UniProt AC | Q8WWY7 | |
| Protein Name | WAP four-disulfide core domain protein 12 | |
| Gene Name | WFDC12 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 111 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Antibacterial protein. Putative acid-stable proteinase inhibitor.. | |
| Protein Sequence | MGSSSFLVLMVSLVLVTLVAVEGVKEGIEKAGVCPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MGSSSFLVLM -----CCCHHHHHHH | 22.85 | 22496350 | |
| 5 | Phosphorylation | ---MGSSSFLVLMVS ---CCCHHHHHHHHH | 25.05 | 22496350 | |
| 12 | Phosphorylation | SFLVLMVSLVLVTLV HHHHHHHHHHHHHHH | 9.97 | 22496350 | |
| 17 | Phosphorylation | MVSLVLVTLVAVEGV HHHHHHHHHHHHHHH | 16.02 | 22496350 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WFD12_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WFD12_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WFD12_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of WFD12_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...