FACE2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FACE2_HUMAN
• UniProt AC: Q9Y256
• Protein Name: CAAX prenyl protease 2
• Gene Name: RCE1
• Organism: Homo sapiens (Human).
• Sequence Length: 329
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: Proteolytically removes the C-terminal three residues of farnesylated and geranylated proteins. Seems to be able to process K-Ras, N-Ras, H-Ras, RAP1B and G-gamma-1. [PubMed: 10085068]
• Protein Sequence: MAALGGDGLRLLSVSRPERPPESAALGGLGPGLCCWVSVFSCLSLACSYVGSLYVWKSELPRDHPAVIKRRFTSVLVVSSLSPLCVLLWRELTGIQPGTSLLTLMGFRLEGIFPAALLPLLLTMILFLGPLMQLSMDCPCDLADGLKVVLAPRSWARCLTDMRWLRNQVIAPLTEELVFRACMLPMLAPCMGLGPAVFTCPLFFGVAHFHHIIEQLRFRQSSVGNIFLSAAFQFSYTAVFGAYTAFLFIRTGHLIGPVLCHSFCNYMGFPAVCAALEHPQRRPLLAGYALGVGLFLLLLQPLTDPKLYGSLPLCVLLERAGDSEAPLCS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAALGGDGL ------CCCCCCCCE	16.05	22814378
13	Phosphorylation	GDGLRLLSVSRPERP CCCEEEEEECCCCCC	23.73	24719451
15	Phosphorylation	GLRLLSVSRPERPPE CEEEEEECCCCCCCC	38.45	24719451
69	Ubiquitination	RDHPAVIKRRFTSVL CCCCHHHHHCCCEEE	30.81	21906983
147	Ubiquitination	CDLADGLKVVLAPRS CCCCCCCEEEECCHH	35.51	-
160	Phosphorylation	RSWARCLTDMRWLRN HHHHHHHHHHHHHHH	31.23	29978859
303	Phosphorylation	LLLLQPLTDPKLYGS HHHHCCCCCHHHCCC	57.87	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FACE2_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
48	K	ubiquitylation	'Lys-48' ubiquitination induces its degradation.	19188362
48	K	ubiquitylation	Undergoes 'Lys-48'- and 'Lys-63'-linked ubiquitination.	19188362

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FACE2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BBS4_HUMAN	BBS4	physical	27173435

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.