UniProt ID | TIM22_HUMAN | |
---|---|---|
UniProt AC | Q9Y584 | |
Protein Name | Mitochondrial import inner membrane translocase subunit Tim22 | |
Gene Name | TIMM22 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 194 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | Essential core component of the TIM22 complex, a complex that mediates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. In the TIM22 complex, it constitutes the voltage-activated and signal-gated channel. Forms a twin-pore translocase that uses the membrane potential as external driving force in 2 voltage-dependent steps (By similarity).. | |
Protein Sequence | MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
46 | Phosphorylation | PRLLEPGSLGGIPSP CCCCCCCCCCCCCCC | 34.26 | 20873877 | |
52 | Phosphorylation | GSLGGIPSPAKSEEQ CCCCCCCCCCCHHHH | 35.25 | 27050516 | |
55 | Ubiquitination | GGIPSPAKSEEQKMI CCCCCCCCHHHHHHH | 62.88 | 27667366 | |
108 | Phosphorylation | DPKDPYRTPTAKEVL CCCCCCCCCCHHHHH | 21.10 | 27251275 | |
110 | Phosphorylation | KDPYRTPTAKEVLKD CCCCCCCCHHHHHHH | 50.15 | 27251275 | |
112 | Ubiquitination | PYRTPTAKEVLKDMG CCCCCCHHHHHHHHH | 51.32 | 27667366 | |
116 | Ubiquitination | PTAKEVLKDMGQRGM CCHHHHHHHHHHHHH | 51.34 | 24816145 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TIM22_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TIM22_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TIM22_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of TIM22_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...