dbPTM

CN183_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CN183_HUMAN
UniProt AC	Q8WXQ3
Protein Name	Putative uncharacterized protein encoded by LINC01599 {ECO:0000312\|HGNC:HGNC:27285}
Gene Name	LINC01599 {ECO:0000312\|HGNC:HGNC:27285}
Organism	Homo sapiens (Human).
Sequence Length	324
Subcellular Localization
Protein Description
Protein Sequence	MEVLGFSNSKMDVRAKRQLEIWMEMAPSKPEPQGKAQQSQPTSVLSAANAAQRGKCCCCREGHSPEDYGRQWAENVENHPEVAAHTSCLQSITPHFIAGEMGCTAKESQEQVPASITQILRNPWFSRLDSPRSRCLHLASSVDPIPGLQFFIVIVSDHQKVDREEEWKQGKIRKEIHWIPLFTMWSWLQCVEDRSIAGIPKLEHGDSHQTESLLDVLVGGFWGVPHTAPPRLQEAGGPTGGCGVGGQPLGGRGQWVGEETGPVGGPHAWWVPPTAPGTSLVLLVLLAQPFQSSEWMPVSSHTPPGTQTNTAALLNVCTSYSEYV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
130	Phosphorylation	PWFSRLDSPRSRCLH CCHHCCCCCCHHHHH	27.14	23532336
293	Phosphorylation	LAQPFQSSEWMPVSS HHCCCCCCCCCCCCC	25.21	25137130

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CN183_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CN183_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CN183_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of CN183_HUMAN !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CN183_HUMAN

Related Literatures of Post-Translational Modification