| UniProt ID | AAKB_SCHPO | |
|---|---|---|
| UniProt AC | P78789 | |
| Protein Name | 5'-AMP-activated protein kinase subunit beta | |
| Gene Name | amk2 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 298 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Beta subunit of AMP-activated protein kinase (AMPK), which is required for transcriptional, metabolic, and developmental adaptations in response to glucose limitation. Has a structural role, mediating heterotrimer formation, and a regulatory role, defining carbon source-regulated subcellular location and substrate specificity of the AMPK kinase complex.. | |
| Protein Sequence | MGNVQSQEGETRAHAVPSQDATTTPDNANNVPKEPRAQSMISIAADDLNQEGEMSDDNQQEGGNNRTSQNGTSGSSGHTKRRSQTSGKKTHQPYSGPCVPTIIRWRGGGEVVYVTGSFSRWKKKIQLLKSEDYTVLLQLRPGTQRFKFLVDGIWCCSSDFPTATDAEGNLYNYLEVEANEKLGASIDERLSQVHTDLPMEEKSESEQYSTEIPAFLTSNTLQELKLPKPPSLPPHLEKCILNSNTAYKEDQSVLPNPNHVLLNHLAAANTQLGVLALSATTRYHRKYVTTAMFKNFDV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 23 | Phosphorylation | VPSQDATTTPDNANN CCCCCCCCCCCCCCC | 29996109 | ||
| 24 | Phosphorylation | PSQDATTTPDNANNV CCCCCCCCCCCCCCC | 29996109 | ||
| 39 | Phosphorylation | PKEPRAQSMISIAAD CCCHHHHHHHHHEEC | 25720772 | ||
| 42 | Phosphorylation | PRAQSMISIAADDLN HHHHHHHHHEECCCC | 25720772 | ||
| 55 | Phosphorylation | LNQEGEMSDDNQQEG CCCCCCCCCCCCCCC | 28889911 | ||
| 185 | Phosphorylation | ANEKLGASIDERLSQ HHHHHCCCHHHHHHH | 24763107 | ||
| 191 | Phosphorylation | ASIDERLSQVHTDLP CCHHHHHHHHHCCCC | 24763107 | ||
| 203 | Phosphorylation | DLPMEEKSESEQYST CCCCCCCCHHHCCCC | 21712547 | ||
| 205 | Phosphorylation | PMEEKSESEQYSTEI CCCCCCHHHCCCCHH | 29996109 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AAKB_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AAKB_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AAKB_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
