dbPTM

MFM2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MFM2_SCHPO
UniProt AC	P34069
Protein Name	M-factor
Gene Name	mfm2
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	44
Subcellular Localization	Cell membrane Lipid-anchor Cytoplasmic side .
Protein Description	M-factor is a mating pheromone produced by M-type mating cells. All three mfm genes contribute to the production of M-factor..
Protein Sequence	MDSIATNTHSSSIVNAYNNNPTDVVKTQNIKNYTPKVPYMCVIA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
41	Farnesylation	TPKVPYMCVIA---- CCCCCEEEEEC----	1.33	1547790
41	Farnesylation	TPKVPYMCVIA---- CCCCCEEEEEC----	1.33	1547790
41	Methylation	TPKVPYMCVIA---- CCCCCEEEEEC----	1.33	1547790

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MFM2_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MFM2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MFM2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of MFM2_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MFM2_SCHPO

Related Literatures of Post-Translational Modification

Methylation
Reference	PubMed
"Mating pheromones of the fission yeast Schizosaccharomyces pombe:purification and structural characterization of M-factor and isolationand analysis of two genes encoding the pheromone."; Davey J.; EMBO J. 11:951-960(1992). Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], PROTEIN SEQUENCE OF 33-41,ISOPRENYLATION AT CYS-41, AND METHYLATION AT CYS-41.	1547790 [Abstract]
Prenylation
Reference	PubMed
"Mating pheromones of the fission yeast Schizosaccharomyces pombe:purification and structural characterization of M-factor and isolationand analysis of two genes encoding the pheromone."; Davey J.; EMBO J. 11:951-960(1992). Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], PROTEIN SEQUENCE OF 33-41,ISOPRENYLATION AT CYS-41, AND METHYLATION AT CYS-41.	1547790 [Abstract]