YA55_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YA55_SCHPO
• UniProt AC: Q09735
• Protein Name: Putative aminopeptidase C13A11.05
• Gene Name: SPAC13A11.05
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 513
• Subcellular Localization: Cytoplasm.
• Protein Sequence: MKGLGLSTRTFNWSSLSSILLPRIPLATTKADSLILAVRHDKQVFSEDYRQVVDQYFETSPKKNDIRLFWNTQGFVRLAIVQLEENVSEKSVRSAAAEAAKILKSNGAKSIAVDGMGFPKDAALGAALATYDFSLRRDHLSVYQDEKVVEKENLFTSPAPERLTFQLLSNTSEKKTATAEENAFKVGLIEAAAQNLARSLMECPANYMTSLQFCHFAQELFQNSSKVKVFVHDEKWIDEQKMNGLLTVNAGSDIPPRFLEVQYIGKEKSKDDGWLGLVGKGVTFDSGGISIKPSQNMKEMRADMGGAAVMLSSIYALEQLSIPVNAVFVTPLTENLPSGSAAKPGDVIFMRNGLSVEIDNTDAEGRLILADAVHYVSSQYKTKAVIEASTLTGAMLVALGNVFTGAFVQGEELWKNLETASHDAGDLFWRMPFHEAYLKQLTSSSNADLCNVSRAGGGCCTAAAFIKCFLAQKDLSFAHLDIAGVMDKQLNSWDCDGMSGRPVRTIIEVARKY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
445	Phosphorylation	LKQLTSSSNADLCNV HHHHHCCCCCCCCCC	35.49	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YA55_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YA55_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YA55_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YA55_SCHPO	ysp2	physical	26771498
IMA2_SCHPO	imp1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.