IMA2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: IMA2_SCHPO
• UniProt AC: O94374
• Protein Name: Importin subunit alpha-2
• Gene Name: imp1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 539
• Subcellular Localization: Cytoplasm. Nucleus, nucleolus. Nucleus; nucleolus; nuclear rim.
• Protein Description: Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors. Active directional transport is assured by both, a Phe-Gly (FG) repeat affinity gradient for these transport factors across the NPC and a transport cofactor concentration gradient across the nuclear envelope. Involved in nuclear protein import. Required for efficient nuclera import of both an SV40 nuclear localization signal-containing reporter protein and the pap1 component of the stress response MAP kinase pathway. Required for proper mitotic progression..
• Protein Sequence: MESRYLSDRRSRFKSKGVFKADELRRQREEQQIEIRKQKREESLNKRRNLNAVLQNDIDVEEEADQSQVQMEQQMKDEFPKLTADVMSDDIELQLGAVTKFRKYLSKETHPPIDQVIACGVVDRFVQFLESEHHLLQFEAAWALTNIASGTTDQTRIVVDSGAVPRFIQLLSSPEKDVREQVVWALGNIAGDSSACRDYVLGNGVLQPLLNILQSSASDVSMLRNATWTLSNLCRGKNPPPNWSTISVAVPILAKLLYSEDVEIIVDACWAISYLSDGPNEKIGAILDVGCAPRLVELLSSPSVNIQTPALRSVGNIVTGTDAQTQIIIDCGALNAFPSLLSHQKENIRKEACWTISNITAGNTQQIQAIIESNLIPPLVHLLSYADYKTKKEACWAISNATSGGLGQPDQIRYLVSQGVIKPLCDMLNGSDNKIIQVALDAIENILKVGEMDRTMDLENINQYAVYVEEAGGMDMIHDLQSSGNNDIYLKAYSIIEKYFSDEDAVEDLAPETENGAFTFGNGPQAQGEFKFDSQDMAM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
43	Phosphorylation	RKQKREESLNKRRNL HHHHHHHHHHHHHCH	32.27	21712547
67	Phosphorylation	VEEEADQSQVQMEQQ HHHHHHHHHHHHHHH	32.63	21712547
494	Phosphorylation	DIYLKAYSIIEKYFS CEEEHHHHHHHHHCC	23.19	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of IMA2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of IMA2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of IMA2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IMA1_SCHPO	cut15	genetic	15937127
ELP3_SCHPO	elp3	genetic	19547744
PHP4_SCHPO	php4	physical	25330182
SIR2_SCHPO	sir2	physical	26771498
YH7G_SCHPO	SPBC16G5.16	physical	26771498
YBH8_SCHPO	SPBC3B8.08	physical	26771498
ASSY_SCHPO	arg12	physical	26771498
TAS3_SCHPO	tas3	physical	26771498
CAN_SCHPO	nce103	physical	26771498
TDG_SCHPO	thp1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.