dbPTM

TDG_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	TDG_SCHPO
UniProt AC	O59825
Protein Name	G/U mismatch-specific uracil DNA glycosylase
Gene Name	thp1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	325
Subcellular Localization	Nucleus .
Protein Description	Removes uracil from G/U mispairs in ssDNA. Also corrects G/G mispairs. Does not catalyze the removal of thymine from G/T mispairs..
Protein Sequence	MNDIETRDTGTKNDNSSEFNLSVKSHKRKRSFDDENLELEESREETSGGILKKAKTQSFSESLERFRFAHAGSNNEYRKTDVVKNSDTDNGLLKSAVETITLENGLRNRRVNVTKKSTLKASVKKSTLKKKNEVDPALLQGVPDYICENPYAIIVGLNPGITSSLKGHAFASPSNRFWKMLNKSKLLEGNAEFTYLNDKDLPAHGLGITNLCARPSSSGADLRKEEMQDGARILYEKVKRYRPQVGLFISGKGIWEEMYKMLTGKKLPKTFVFGWQPEKFGDANVFVGISSSGRAAGYSDEKKQNLWNLFAEEVNRHREIVKHAV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
31	Phosphorylation	KSHKRKRSFDDENLE HHCCCCCCCCCCCCC	35.74	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of TDG_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of TDG_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of TDG_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of TDG_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of TDG_SCHPO

Related Literatures of Post-Translational Modification